Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18840-AT1G74690
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):IQ-domain 30
Function (paralog2):IQ-domain 31

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.4789859311445
Log2 mRNA fold difference:1.1846221259412
Log2 TE fold difference:0.26381650770176
Sequences
Protein sequence

MGKPARWLKSVLLGKKPSKSSGSKDKERIVNGKEVVVISKIEESDVVSDLSSIGNAAVYT
SGIVETQNLKHEDVSDDEIQVSEVQPTDSQDVASVPDDSLSESEKIQQEIAAVTVQAAYR
GYLARRAFKILKGIIRLQALIRGHMVRRQAVSTLCCVMGIVRLQALARGREIRHSDIGVE
VQRKCHLHHQPLENKANSVVDTHSYLGINKLTGNAFAQKLLASSPNVLPLSLDNDSSNSI
WLENWSASCFWKPVPQPKKASLRKSQKKFASNPQIVEAEFARPKKSVRKVPSSNLDNSSV
AQTSSELEKPKRSFRKVSTSQSVEPLPSMDNPQVDLEKVKRGLRKVHNPVVENSIQPQLV
PQIAVEKPNGSLEESVNAFDEEKEDEVAETVVQQPEELIQTHTPLGTNESLDSTLVNQIE
ESEENVMAEEKEDVKEERTPKQNHKENSAGKENQKSGKKASSVTATQTAEFQESGNGNQT
SSPGIPSYMQATKSAKAKLRLQGSSSPRQLGTTEKASRRYSLPSSGNSAKITSHSPKTRV
SNSSGKSGNKTEKTLLSSREGNGKATPVEWKR

MGKSTKWLKNVLLGKKTSKSSGSKDKERVVSGKEVLVTSKVEESDVVSDLPSFEVAETNT
VDRSGGMLETQNVGPEEISDDEIELPEGKSTDSQNVAPVQDHSLSDAERIQREIAATSVQ
AAFRGYLARRAFWALKGIIRLQALIRGHLVRRQAVATLFSVMGIVRLQAFARGREIRKSD
IGVQVYRKCRLQLLQGNKLANPTDAYLGIKKLTANAFAQKLLASSPKVLPVHAYDTSNPN
SNLIWLENWSASCFWKPVPQPKKTISRKPQNRLLVEAESAKPKKSVRKVPASNFESSSVQ
TSFEFEKPKRSFRKVSSQSIEPPAVEDPQIELEKVKRSLRKVHNPVVESSIQPQRSPRKE
VEKPKLGVEKTRESSYPLVHETAEEPVNVCDEKKKQEISEQPEEEVHALEMEVHTPGPLE
TNEALDSSLVNQIDSNEKAMVEEKPSMEKDTKEEKTPKPNNKENSAGKENQKSRKKGSAT
SKTEREESNGHHETSPSIPSYMQATKSAKAKLRLQGSPKSAEQDGTEKATVPRRHSLPSP
GNGRITSHSPRTTRLANSGDKTGNKKEKPLLSSREGNAKTTPAERKR

Other information
Ka divergence:0.0230711KaKs divergence:-0.116591
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1719Length 2 (bp):1764Length divergence:0.013
MFE 1 (kcal):-494.05MFE 2 (kcal):-522.72MFE divergence0.028