Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18870-AT1G74710
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):isochorismate synthase 2
Function (paralog2):ADC synthase superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.25688826817037
Log2 mRNA fold difference:-0.38630245237762
Log2 TE fold difference:0.12825776233936
Sequences
Protein sequence

MASLQCSFHFLGTNPKKYNPSSIFQSYSRTSFTKLSSRVSRQRFLRCTLSMNGCEADHKA
PLGTVETRTLSTVPSPAAATERLITAVSDLKSQPPPFSSGIVRLQVPIEQKIGAIDWLHA
QNEILPRSFFSRRSDSGRPDLLQDFSSDNGSSDHNPVSVAGIGSAVFFRDLDPFSHDDWR
SIRRFLSSKSPLIRAYGGLRFDPTGKIAVEWEHFGSFYFTVPQVEFDEFGGSSMLAATVA
WDNELSWTLENAIEALQETMLQVSSVIMRLRRESLGVIVVSKNHVPSEGAYYPAVNNALE
IIKDKHSPLSKVVLARSSRIITDTDIDPIAWLARLQCEGQDAYQFCLQPPGAPAFIGNTP
ERLFHRKHLGVCSEALAATRPRGDSKVREMEIERDLLTSPKDDLEFSIVRENIREKLKTI
CDRVVVKPHKSVRKLARVQHLYSQLAGQLKREDDEFNILTALHPTPAVCGCPVEEARLLI
KQIESFDRGMYAGPIGFFGGGESEFSVGIRSALVEKGLGALIYAGTGIVSGSNPSSEWNE
LELKISQFTKSLEHESALQPIN

MASLQFSSQFLGSNTKTHSSIISISRSYSPTPFTRFSRKKYESCSMSMNGCDGDFKTPLG
TVETRTMTAVLSPAAATERLISAVSELKSQPPSFSSGVVRLQVPIDQQIGAIDWLQAQNE
IQPRCFFSRRSDVGRPDLLLDLANENGNGNGNGTVSSDRNLVSVAGIGSAVFFRDLDPFS
HDDWRSIRRFLSSTSPLIRAYGGMRFDPNGKIAVEWEPFGAFYFSVPQVEFNEFGGSSML
AATIAWDDELSWTLENAIEALQETMLQVSSVVMKLRNRSLGVSVLSKNHVPTKGAYFPAV
EKALEMINQKSSPLNKVVLARNSRIITDTDIDPIAWLAQLQREGHDAYQFCLQPPGAPAF
IGNTPERLFQRTQLGVCSEALAATRPRAASSARDMEIERDLLTSPKDDLEFSIVRENIRE
KLNGICDRVVVKPQKTVRKLARVQHLYSQLAGRLTKEDDEYKILAALHPTPAVCGLPAEE
ARLLIKEIESFDRGMYAGPIGFFGGEESEFAVGIRSALVEKGLGALIYAGTGIVAGSDPS
SEWNELDLKISQVRAFVQKMFSDIMVLCYQNPNFYSLFCCCFCSSPSQLNMKQQHLYRRL
IEERVTFVFDCFVCMGDKGFSQ

Other information
Ka divergence:0.264141KaKs divergence:0.260767
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1689Length 2 (bp):1869Length divergence:0.051
MFE 1 (kcal):-506.21MFE 2 (kcal):-570.66MFE divergence0.06