Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18890-AT1G74740
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):calcium-dependent protein kinase 1
Function (paralog2):calcium-dependent protein kinase 30

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.2553097077842
Log2 mRNA fold difference:-0.34394249646691
Log2 TE fold difference:0.2329596873455
Sequences
Protein sequence

MGNCNACVRPDSKESKPSSKPKKPNRDRKLNPFAGDFTRSPAPIRVLKDVIPMSNQTQIS
DKYILGRELGRGEFGITYLCTDRETHEALACKSISKRKLRTAVDIEDVRREVAIMSTLPE
HPNVVKLKASYEDNENVHLVMELCEGGELFDRIVARGHYTERAAAAVARTIAEVVMMCHS
NGVMHRDLKPENFLFANKKENSPLKAIDFGLSVFFKPGDKFTEIVGSPYYMAPEVLKRDY
GPGVDVWSAGVIIYILLCGVPPFWAETEQGVALAILRGVLDFKRDPWPQISESAKSLVKQ
MLDPDPTKRLTAQQVLAHPWIQNAKKAPNVPLGDIVRSRLKQFSMMNRFKKKVLRVIAEH
LSIQEVEVIKNMFSLMDDDKDGKITYPELKAGLQKVGSQLGEPEIKMLMEVADVDGNGFL
DYGEFVAVIIHLQKIENDELFKLAFMFFDKDGSTYIELDELREALADELGEPDASVLSDI
MREVDTDKDGRINYDEFVTMMKAGTDWRKASRQYSRERFKSLSINLMKDGSLHLHDALTG
QTVPV

MGNCIACVKFDPDNSKPNQKKKPPRGRQRNPYDDPDGLRTHAPLRVIPMSHQSQISDKYI
LGRELGRGEFGITYLCTDRETREALACKSISKRKLRTAVDVEDVRREVTIMSTLPEHPNV
VKLKATYEDNENVHLVMELCEGGELFDRIVARGHYTERAAATVARTIAEVVRMCHVNGVM
HRDLKPENFLFANKKENSALKAIDFGLSVLFKPGERFTEIVGSPYYMAPEVLKRNYGPEV
DVWSAGVILYILLCGVPPFWAETEQGVALAILRGVLDFKRDPWSQISESAKSLVKQMLEP
DSTKRLTAQQVLDHPWIQNAKKAPNVPLGDIVRSRLKQFSMMNRLKKKALRVIAEHLSIQ
EVEVIRNMFTLMDDDNDGKISYLELRAGLRKVGSQLGEPEIKLLMEVADVNGNGCLDYGE
FVAVIIHLQKMENDEHFRQAFMFFDKDGSGYIESEELREALTDELGEPDNSVIIDIMREV
DTDKDGKINYDEFVVMMKAGTDWRKASRQYSRERFKSLSLNLMKDGSMHLHDALTGQSIA
V

Other information
Ka divergence:-0.0471913KaKs divergence:0.143782
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1638Length 2 (bp):1626Length divergence:-0.004
MFE 1 (kcal):-487.84MFE 2 (kcal):-494.86MFE divergence0.007