Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18900-AT1G74750
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pentatricopeptide repeat (PPR) superfamily protein
Function (paralog2):Pentatricopeptide repeat (PPR) superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.4652295607763
Log2 mRNA fold difference:-1.7543265133004
Log2 TE fold difference:0.43019140643756
Sequences
Protein sequence

MIRAKHISNLSSTARSFFLNGSRTSVTDGNSCVYSDDENCVSKRQQLRKEAGQTEKRPSS
ILPKPSVVGCILPGEVTKPVVPKKVDDFGRPSLLPQHVSSSPALPLKSHSVNYASTVVRE
EVEGKASSEPIGDQIFKAGIVAVNFLSDLSNCKIPSYDGGSDAFGLPKSCMVDPTRPISS
VKSSNVKAIRREHFAKIYPRSAAKESSVGTTRNPSSNFRGAKEAERTGFVKGFRQVSNSV
VGKSLPTTNNTYGKRTSVLQRPHIDSNRFVPSGFSNSSVEMMKGPSGTALTSRQYCNSGH
IVENVSSVLRRFRWGPAAEEALQNLGLRIDAYQANQVLKQMNDYGNALGFFYWLKRQPGF
KHDGHTYTTMVGNLGRAKQFGAINKLLDEMVRDGCQPNTVTYNRLIHSYGRANYLNEAMN
VFNQMQEAGCKPDRVTYCTLIDIHAKAGFLDIAMDMYQRMQAGGLSPDTFTYSVIINCLG
KAGHLPAAHKLFCEMVDQGCTPNLVTYNIMMDLHAKARNYQNALKLYRDMQNAGFEPDKV
TYSIVMEVLGHCGYLEEAEAVFTEMQQKNWIPDEPVYGLLVDLWGKAGNVEKAWQWYQAM
LHAGLRPNVPTCNSLLSTFLRVNKIAEAYELLQNMLALGLRPSLQTYTLLLSCCTDGRSK
LDMGFCGQLMASTGHPAHMFLLKMPAAGPDGENVRNHANNFLDLMHSEDRESKRGLVDAV
VDFLHKSGQKEEAGSVWEVAAQKNVFPDALREKSCSYWLINLHVMSEGTAVTALSRTLAW
FRKQMLASGTCPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNIFGSPFFTESGNSGCFVG
SGEPLNRWLLQSHLVSHKLRLELDRMECLSSLLSSASQLYLPLVII

MIRAKHISNLSSSARSFFLSGSRPSAADGNSCTCAEDESGVSKRQQIRTEVVQTGKRASN
LAAGLAGSILPVEAGKPLVVPKTVEHFTRPSLLPQHVSSPALPGKADSVNHASAIIKEDV
GVPIGDQIFKAGIGNVNLLSDIANYKIPLSDGTEVVGLPKSCMVDPTRPISGVKSSNVKV
IRREHLAKVYPRSADRVPINSSPGTKQASNDVAGKSFEAHDLLSNNVSGKRKIMPQRPYT
DSTRYASGGCDYSVHSSDDRTIISSVEGFGKPSREMMKVTPRTAPTPRQHCNPGYVVENV
SSILRRFKWGHAAEEALHNFGFRMDAYQANQVLKQMDNYANALGFFYWLKRQPGFKHDGH
TYTTMVGNLGRAKQFGEINKLLDEMVRDGCKPNTVTYNRLIHSYGRANYLKEAMNVFNQM
QEAGCEPDRVTYCTLIDIHAKAGFLDIAMDMYQRMQEAGLSPDTFTYSVIINCLGKAGHL
PAAHRLFCEMVGQGCTPNLVTFNIMIALHAKARNYETALKLYRDMQNAGFQPDKVTYSIV
MEVLGHCGFLEEAEGVFAEMQRKNWVPDEPVYGLLVDLWGKAGNVDKAWQWYQAMLQAGL
RPNVPTCNSLLSTFLRVHRMSEAYNLLQSMLALGLHPSLQTYTLLLSCCTDARSNFDMGF
CGQLMAVSGHPAHMFLLKMPPAGPDGQKVRDHVSNFLDFMHSEDRESKRGLMDAVVDFLH
KSGLKEEAGSVWEVAAGKNVYPDALREKSYSYWLINLHVMSEGTAVIALSRTLAWFRKQM
LVSGDCPSRIDIVTGWGRRSRVTGTSMVRQAVEELLNIFNFPFFTENGNSGCFVGSGEPL
KNWLLESYVERMHLL

Other information
Ka divergence:-0.047029KaKs divergence:0.0513078
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2661Length 2 (bp):2568Length divergence:-0.018
MFE 1 (kcal):-826.23MFE 2 (kcal):-826.94MFE divergence0