Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18940-AT1G74780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nodulin-like / Major Facilitator Superfamily protein
Function (paralog2):Nodulin-like / Major Facilitator Superfamily protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.7866220419884
Log2 mRNA fold difference:2.0310241240062
Log2 TE fold difference:-0.42416934766314
Sequences
Protein sequence

MATEILRTKWMAMTASIWIQCSAGGSYTFGIYSAILKSTQSYDQSTLDTVSVFKDIGGNV
GVLSGLVYTAATFNRRRRDGRERRGGPWVVILIGAILNFTGYFLMWASVTGLIKRPPVPV
MCLFMFIAAQSLTFLNTANVVSSLENFADYGGTAVGIMKGFVGLSGAMLIQLYEVVCPGD
PKTFILLLAIVPSLLSVLVMPLVRVYKTSTVDEKKHLDGLSTLSLIIAAYLMITIILKST
LSLPSWANAVTLAVLLVLLSSPLLVAVRAHRDSIEKPLSSVYSPLVDNLEATTSGEILML
DEDKSLNLLQAMCNVDFWLLFLAMICGMGSGISTINNIRQIGESLRYTSVEINSLLALWN
IWNFIGRFGGGYVSDWLLHRKGWPRPLLMATTLGTMTIGHLIIASGFQGNLYPGSIIVGI
CYGSQWSLMPTITSELFGVKHMGTIYNTISIASPMGSYIFSVRLIGYIYDRTIIGEGNTC
YGPHCFRLAYVVIASVAFLGFLVSCVLVFRTKTIYRQIFEKILHRR

MEILRTKWVAMTASIWIQCASGASYTFGIYSAVLKSTQSYDQSTLDTVSVFKDIGANAGV
FSGLLYTYATSNRLRGRGGGIGGAGGPWVVLAVGAIQCFAGYFLIWASVTGLIRKPPVPL
MCLFMFLAAQSQTFFNTANVVSAVENFADYGGTAVGIMKGFLGLSGAILIQLYETLCAGD
PASFILLLAVTPTVLSLLVMPLVRIYETSVADDKKHLNGLSAVSLIIAAYLMIIIILKNT
FGLSSWANIVTLVCLLVMLALPLLIARRAQRDGMEKTVPHDYSPLISSPKATTSGNQSSE
GDSKVEAGLSENLNLLQAMKKLSFWLLFLAMICGMGSGLSTINNIRQIGESLRYSSVEIN
SLVSLWSIWNFLGRFGAGYASDALLHKKGWPRPLLMAATLGTMSIGHLIIASGFQGNLYV
GSVIVGVCYGSQWSLMPTITSELFGIRHMGTIFNTISVASPIGSYIFSVRLIGYIYDKTA
SGEGNTCYGSHCFRLSFIIMASVAFFGFLVAIVLFFRTKTLYRQILVKRLHHR

Other information
Ka divergence:-0.380695KaKs divergence:-0.291608
GC content 1 (%):42GC content 2 (%):45GC content divergence:0.034
Length 1 (bp):1581Length 2 (bp):1602Length divergence:0.007
MFE 1 (kcal):-458.7MFE 2 (kcal):-498.24MFE divergence0.041