Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G18970-AT1G18980
Species:Arabidopsis
Duplication type:TD
Function (paralog1):germin-like protein 4
Function (paralog2):RmlC-like cupins superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:4.6919896937343
Log2 mRNA fold difference:4.017119468086
Log2 TE fold difference:0.59738344494503
Sequences
Protein sequence

MATLQIPSALLRSFLLMFCLFVIPSLSSDSDPLQDFCVGDLKASASINGFPCKSAVSASD
FFYSGLGGPLDTSNPNGVTVAPANVLTFPGLNTLGISMNNVELAPGGVNPPHLHPRATEV
GTVIEGSVFVGFLSTNNTLFSKVLNAGEAFVIPRGLVHFQWNVGQVKARMITAFNSQLPG
AVVLPSTLFGSKPEIPNAVLTRAFRTDDTTVQNLKSKFAV

MTTLQISSSLFRSFLLVICVFVIPSLSSDSDPLQDFCVGDLKASPSINGFPCKSSVSASD
FFFSGLGGPLNTSTPNGVAVSPANVLTFPGLNTLGLSMNNVEFAPGGVNPPHSHPRATEA
GVVIEGSVFVGFLTTNNTLFSKVLNAGEMFVVPRGLVHFQWNVGKVKARLITSFNSQLPG
SAVLPSTLFGSNPTIPNAVLTKTFRTDDVTVNKLKSKFAV

www.000webhost.com

Other information
Ka divergence:-0.23062KaKs divergence:0.0789381
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):663Length 2 (bp):663Length divergence:0
MFE 1 (kcal):-185.24MFE 2 (kcal):-164.94MFE divergence-0.058