Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19000-AT1G74840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Homeodomain-like superfamily protein
Function (paralog2):Homeodomain-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.4005343604466
Log2 mRNA fold difference:-1.9381647407149
Log2 TE fold difference:-0.4782931119619
Sequences
Protein sequence

MAAVSSSSETGDCGVTGKRDEIMLFGVRVVVDPMRKCVSLNNLSDYEKSSPEDEIPKIVT
AGAGDGEDKNETDATVIVADGYASANDAVQISSSSGGRKRGVPWTENEHKRFLIGLQKVG
KGDWKGISRNFVKSRTPTQVASHAQKYFLRRTNLNRRRRRSSLFDITTETVTEMAMEQDP
TQENSPLPETNISSGQQAMQVFTDVPTKTENAPETFHLNDPYLVPVTFQAKPTFNLNTDA
APLSLNLCLASSFNLNEQPNSRHSAFTMMPSFSDGDSNSSIIRVA

MADGSTSSSESTTACAGSGTRREIMLFGVRVVLDPMRKCVSLNNLSDYEQTAETPKIDGE
DRDEQDMNKTPAGYASADEALPMSSSNGKIERKRGVPWTEEEHKLFLLGLQRVGKGDWKG
ISRNFVKTRTSTQVASHAQKYFLRRSNLNRRRRRSSLFDMTTDTVIPMEEDHQVLIQENT
SQSSSPVPEINNFSIHPVMQVFPEFPVPTGNQSYGQLTSSNLINLVPLTFQSSPAPLSLN
LSLASSNLNEPSPSMHPAFNTIGVA

Other information
Ka divergence:-0.276121KaKs divergence:-0.444609
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):858Length 2 (bp):798Length divergence:-0.036
MFE 1 (kcal):-259.46MFE 2 (kcal):-223.86MFE divergence-0.074