Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19010-AT1G74860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.027350017825142
Log2 mRNA fold difference:-0.9745785485893
Log2 TE fold difference:0.97428164907191
Sequences
Protein sequence

MTDPEKLTALKKAYAETILNTAKEAAARVMITERKARGYQQELASVRDEALRACLRLKQI
YDSKVKEAEMISLQKQQKIEELEAQLGEAEDIVGELRTELRESRYLLEKLANGCQTNLSK
EEKAPNEAVSLEVREDSSNHERSVVASVIKPHMSDRDLSINRCSYKENKDPCLYTLPSIL
SRCREAEVVERNTINGDCADVESLTEARKEEAKENDIELSTTPLSPSEKQCIKFSYKRKH
NKDGSNSPEGGGSSSQDDDDDDESRSRRHKTGEKDNAYLDSFTSTEPSRDSRRVAQVARQ
LLPFSEKKGLQQSQCDDVP

MADPETLAALKRAYADTILNTTKEAAARVMVSEKKARRYQQELVTVRNEALHTLVRLKQM
LDSKVKETEMQSLKQQQKVEELEAQLGEAEDIVGELRLELRVLHDELKKLTDGQKHLKKN
HEENLCWNNRDAAVSVMPEVSCSHENTEAVGFCIPVEQNGSVVANGIKVPSLTRINSINR
CSYKDNKDQCHYTLPSILTKRRETEGLAQMIHTVDSSMANGVLSSSVEVGDVNDGVCLHE
VSSCKIVESLEMSGCADATDSISSVKDGEAPIVSPNSSQKDVGTLISLKTSPPREHENDR
KLEISETEARKEEKESCENMEVSASPLCEETPVLALSKNRCIKYTFKRKRKKEVLSNLEG
DSSFEESRNMKQKTVEKDDGYLESLKPSFTSESSRDVVYA

www.000webhost.com

Other information
Ka divergence:-0.326572KaKs divergence:0.224044
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):960Length 2 (bp):1203Length divergence:0.112
MFE 1 (kcal):-278.42MFE 2 (kcal):-359.61MFE divergence0.127