Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19050-AT1G74890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):response regulator 7
Function (paralog2):response regulator 15

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-2.9096382609129
Log2 mRNA fold difference:-2.6084286035561
Log2 TE fold difference:-0.24102020603984
Sequences
Protein sequence

MAVGEVMRMEIPAGGDLTVTTPELHVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRAL
QYLGLDGGKGASNLKDLKVNLIVTDYSMPGLSGYDLLKKIKESSAFREVPVVIMSSENIL
PRIQECLKEGAEEFLLKPVKLADVKRIKQLIMRNEAEECKILSHSNKRKLQEDSDTSSSS
HDDTSIKDSSCSKRMKSESENLFSLL

MALRDLSSSLSSSSSPELHVLAVDDSFVDRKVIERLLKISACKVTTVESGTRALQYLGLD
GDNGSSGLKDLKVNLIVTDYSMPGLTGYELLKKIKESSALREIPVVIMSSENIQPRIEQC
MIEGAEEFLLKPVKLADVKRLKELIMRGGEAEEGKTKKLSPKRILQNDIDSSPSSSSTSS
SSSSHDVSSLDDDTPSSKRIKLESRG

www.000webhost.com

Other information
Ka divergence:-0.147812KaKs divergence:0.63605
GC content 1 (%):40GC content 2 (%):39GC content divergence:-0.013
Length 1 (bp):621Length 2 (bp):621Length divergence:0
MFE 1 (kcal):-167.4MFE 2 (kcal):-158.7MFE divergence-0.027