Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19180-AT1G74950
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):jasmonate-zim-domain protein 1
Function (paralog2):TIFY domain/Divergent CCT motif family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.63147154971359
Log2 mRNA fold difference:-0.12873624208951
Log2 TE fold difference:-0.52644797293352
Sequences
Protein sequence

MSSSMECSEFVGSRRFTGKKPSFSQTCSRLSQYLKENGSFGDLSLGMACKPDVNGTLGNS
RQPTTTMSLFPCEASNMDSMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKP
ESQTAPLTIFYAGQVIVFNDFSAEKAKEVINLASKGTANSLAKNQTDIRSNIATIANQVP
HPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQT
TGNMSWLGLAAEI

MSSFSAECWDFSGRKPSFSQTCTRLSRYLKEKGSFGDLSLGMTCKPDVNGGSRQPTMMNL
FPCEASGMDSSAGQEDIKPKTMFPRQSSFSSSSSSGTKEDVQMIKETTKSVKPESQSAPL
TIFYGGRVMVFDDFSAEKAKEVIDLANKGSAKSFTCFTAEVNNNHSAYSQKEIASSPNPV
CSPAKTAAQEPIQPNPASLACELPIARRASLHRFLEKRKDRITSKAPYQIDGSAEASSKP
TNPAWLSSR

Other information
Ka divergence:0.27238KaKs divergence:0.0301087
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):762Length 2 (bp):750Length divergence:-0.008
MFE 1 (kcal):-195.53MFE 2 (kcal):-210.11MFE divergence0.036