Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19200-AT1G74940
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF581)
Function (paralog2):Protein of unknown function (DUF581)

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.71208925319
Log2 mRNA fold difference:3.3705397026245
Log2 TE fold difference:-0.6181107191955
Sequences
Protein sequence

MVVPGKNSTISPDYFTASQTSPLDMMKFPSPGSSKRYDNGGGIGLGIVAALEKSSIGINP
VCHTGAGSKGFDLARYSKRFQFAAGIDLSDSEEYTCVTTRDGLTKVYYKEEEFEFGHNLL
NGDQRWRKPIEIAEESPAKERRVLRDCPDFLTSCCLCKKKLQGKDIYMYKGDEGFCSKEC
RSLKIMEDSLKEQHKLTSVEVLTGEEIASPGIFLI

MILSKRPHLMIRKLSEMLVPRSRSAAIKPEEYTASPRSPLDLNFPSPVHSKRFGSGGVGL
GIVAALEETSNGINRHDPVRYSGRFRCPEIDLSDEEYTYVTSPNGPTKVYYNDDGFELSE
NDYRRVHKPMVTVDEPPVIERQSVRGPTEFLSSCCLCKKKLQGKDIYMYKGEMGFCSAEC
RSVQIMNDERQEQCKTQVSRNADVLSSPYAAGQRLSAGVFVF

www.000webhost.com

Other information
Ka divergence:-0.259019KaKs divergence:0.0783922
GC content 1 (%):43GC content 2 (%):46GC content divergence:0.034
Length 1 (bp):648Length 2 (bp):669Length divergence:0.016
MFE 1 (kcal):-189.8MFE 2 (kcal):-213.55MFE divergence0.059