Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19320-AT1G75030
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pathogenesis-related thaumatin superfamily protein
Function (paralog2):thaumatin-like protein 3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.6485714214514
Log2 mRNA fold difference:3.2684734909631
Log2 TE fold difference:-1.8938895686608
Sequences
Protein sequence

MAIFSTSHLLFISFIIATCTISVSGTTFTLTNHCGSTIWPGILTANGAQLGDGGFALASG
SSVTFTVSPGWSGRFWARTYCNFDASGSGKCGTGDCGSKLKCAGAGGAPPATLAEFTIGS
SGKKNAVQDFYDVSLVDGYNVQMKITPQGGSGDCKTAGCVSDVNAICPKELQVTGPSGVA
ACKSACEAFNKPEYCCTGAYSTPATCPPTNYSKIFKQACPSAYSYAYDDASSTFTCTNAN
YEISFCS

MAKISSIHILFFVFITSGIADSATVFTLQNSCAYTVWPGTLSGNSITLGDGGFPLTPGAS
VQLTAPTGWSGRFWARTGCNFDASGHGTCVTGDCGGVLKCTGGGVPPATLAEFTVGSSNA
GMDFYDVSLVDGYNVKMGIKPQGGFGNCKYAGCVSDINEICPSELRIMDPNSGSVAACKS
ACAAFSSPEFCCTGAHATPQTCSPTYYSSMFKNACPSAYSYAYDDASSTFTCTGSNYLIT
FCPTQS

Other information
Ka divergence:-0.274077KaKs divergence:-0.798066
GC content 1 (%):50GC content 2 (%):53GC content divergence:0.029
Length 1 (bp):744Length 2 (bp):741Length divergence:-0.002
MFE 1 (kcal):-234.26MFE 2 (kcal):-262.64MFE divergence0.057