Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19330-AT1G75060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.220651767936
Log2 mRNA fold difference:-2.9343585473497
Log2 TE fold difference:0.70225006472321
Sequences
Protein sequence

MLEAVDSSGVVNGGFPQIQSFYGDCSSEEELSVLPRHTKVVVTGNNRTKSVLVGLQGVVK
KAVGLGGWHWLVLTNGIEVKLQRNALSVLEPPTGNEEDDDLDFENTQRNGSDMIVSFPAS
EDTLKPHKSKLRGQRSSRSSHKTMSRSLSSDSQSKSSGFTPPENMQKVDLSKLEMPALLN
YWRHFNLVDAIPNPSKEQLIDIVQRHFMSQQMDELQVIVGFVQAAKRMKKACKFQSKESR
NTDLNCIS

MLEAPVNKSSILNGGGGGFSQLQSCFGDCSSEEELSVLPRHTKVVVTGNNRTKSVLVGLQ
GVVKKAVGLGGWHWLVLTNGIEVKLQRNALSVLEHPTGNEEDNDLEVDHSTQWNHPSDMT
TEDTLKPHKSKKRGHRSSRLSQKALYREVSCDSHSKISSITPRLNMKVDLTKLDMAALLR
YWRHFNLVDALPNPTKEQLIDIIQRHFMSQQMDELQVIVGFVQAATGMKKACQVEDQRSQ
KH

Other information
Ka divergence:0.49049KaKs divergence:0.617565
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):747Length 2 (bp):729Length divergence:-0.012
MFE 1 (kcal):-229.46MFE 2 (kcal):-211.4MFE divergence-0.041