Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19350-AT1G75080
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Brassinosteroid signalling positive regulator (BZR1) family protein
Function (paralog2):Brassinosteroid signalling positive regulator (BZR1) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.1649183678071
Log2 mRNA fold difference:-2.5480131587895
Log2 TE fold difference:0.39119436302797
Sequences
Protein sequence

MKRFFYNSSEEERKKKAYSSKKMTSDGATSTSAAAAAAAMATRRKPSWRERENNRRRERR
RRAVAAKIYTGLRAQGNYNLPKHCDNNEVLKALCSEAGWVVEEDGTTYRKGHKPLPGDMA
GSSSRATPYSSHNQSPLSSTFDSPILSYQVSPSSSSFPSPSRVGDPHNISTIFPFLRNGG
IPSSLPPLRISNSAPVTPPVSSPTSRNPKPLPTWESFTKQSMSMAAKQSMTSLNYPFYAV
SAPASPTHHRQFHAPATIPECDESDSSTVDSGHWISFQKFAQQQPFSASMVPTSPTFNLV
KPAPQQLSPNTAAIQEIGQSSEFKFENSQVKPWEGERIHDVAMEDLELTLGNGKAHS

MTSDGATSTSAAAAAAAAAAARRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGDYNLP
KHCDNNEVLKALCVEAGWVVEEDGTTYRKGCKPLPGEIAGTSSRVTPYSSQNQSPLSSAF
QSPIPSYQVSPSSSSFPSPSRGEPNNNMSSTFFPFLRNGGIPSSLPSLRISNSCPVTPPV
SSPTSKNPKPLPNWESIAKQSMAIAKQSMASFNYPFYAVSAPASPTHRHQFHTPATIPEC
DESDSSTVDSGHWISFQKFAQQQPFSASMVPTSPTFNLVKPAPQQMSPNTAAFQEIGQSS
EFKFENSQVKPWEGERIHDVGMEDLELTLGNGKARG

Other information
Ka divergence:-0.245026KaKs divergence:-0.631434
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1074Length 2 (bp):1011Length divergence:-0.03
MFE 1 (kcal):-307.63MFE 2 (kcal):-309.66MFE divergence0.003