Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19360-AT1G75120
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nucleotide-diphospho-sugar transferase family protein
Function (paralog2):Nucleotide-diphospho-sugar transferase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-4.2454995508361
Log2 mRNA fold difference:-4.6619853031221
Log2 TE fold difference:0.4211420129727
Sequences
Protein sequence

MAGRRDRSQQLRGSRIAIAILIGIFIGCVCAVLFPYGFFNSSSSLKASEHLSKSSNQVGS
SACESPERVKMLKSDFVTLSEKNAELKKQVRELTEKLRLAEQGSDNARKQVLALGTQIKA
GPFGTVKSLRTNPTILPDESINPRLAKILEEIAVDKEVIVALANANVKAMLEVQIASIKR
VGITNYLVVALDDYIENLCKENDVAYYKRDPDKDVDTVGKTGGNHAVSGLKFRVLREFLQ
LGYGVLLSDVDIVFLQNPFSHLYRDSDVESMSDGHDNHTAYGFNDVFDEPAMGWARYAHT
MRIWVFNSGFFYLRPTIPSIELLDRVADRLSKAKVWDQAVFNEELFYPSHPEYTALHASK
RVMDMYEFMNSKVLFKTVRKNHELKKKVKPVIVHVNYHPDKLNRMQAVVEFYVNGKQDAL
DSFPDGSE

MAVRKEKVQPFRECGIAIAVLVGIFIGCVCTILIPNDFVNFRSSKVASASCESPERVKMF
KAEFAIISEKNGELRKQVSDLTEKVRLAEQKEVIKAGPFGTVTGLQTNPTVAPDESANPR
LAKLLEKVAVNKEIIVVLANNNVKPMLEVQIASVKRVGIQNYLVVPLDDSLESFCKSNEV
AYYKRDPDNAIDVVGKSRRSSDVSGLKFRVLREFLQLGYGVLLSDVDIVFLQNPFGHLYR
DSDVESMSDGHDNNTAYGFNDVFDDPTMTRSRTVYTNRIWVFNSGFFYLRPTLPSIELLD
RVTDTLSKSGGWDQAVFNQHLFYPSHPGYTGLYASKRVMDVYEFMNSRVLFKTVRKDEEM
KKLKPVIIHMNYHSDKLERMQAAVEFYVNGKQDALDRFRDGS

Other information
Ka divergence:0.580318KaKs divergence:0.621062
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1287Length 2 (bp):1209Length divergence:-0.031
MFE 1 (kcal):-383.94MFE 2 (kcal):-373.35MFE divergence-0.014