Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19370-AT1G75140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.65132938607323
Log2 mRNA fold difference:-0.2740333415774
Log2 TE fold difference:-0.38101344566427
Sequences
Protein sequence

MADPLNGKSFFICFSLLFSFTLLFISPLYATESPVIEDVSTDVAVSVSETNREAVLLHNL
EELVKNLTELVANLDAKLSATPLKEKNEISVDDDIGEEKERGRAKAFSVTKYSPFWSERF
QFTSAVKLNSDATCINVLPFRDFEGSSKYFAIGDSKGRVYVFLRNGDVLIEFFTTVDSPV
TAMVSYSSVFKNSSFVVTGHQNGAVLLHRIHEGSNGEDWNSNSVSMEHVGKFDVDDSADP
VTLLEVHHVGRVRYILATDLSGKLTVLTENRTVYGSVIPSSRPLVFLKQRLLFLTESGAG
SLDLRSMKIRETECEGLNHSLARTYVFDAAERSKAYGFTSEGEIIHVLLHGDIMNFKCRV
RSKKKFQMEEPVALQSIKGYLLVINEEKVFAFNVSTQHYVRTAGPRLLFSAGLEEIRSAF
LSHRESSSRTTTVVKTRPLIASDRENLLVIGLENGYFAVYKSKLPTLKGDFNTMLWSSPV
FFFILFLFGAWHFFAKKKESLTAWGPDDPFTPTGAQNSSAKEPTFTEPSRRNDDLMDLRR
RYAGGSYRSVGANDPSSRAPVDGNYRTTAQDHNNYRGGGSGLDSNGFGNRRDHLFGNNKV
LDNES

MADSQNGKSAFFFFFVSLILLFLSPSYSDVTASESDPIPYENSDASPGVVTSSESDRQGV
SLHRLEELVRNLTELVARLDAKLSETPFKVKKEITRDEIEEKAKAFSVTKYSPFWSERFE
FTSAVKLDSEATCINVLPFRDHEGLSKYFAVGDSSGRVFVFLRNGDVLVEFFTTCDSPIT
AMVSYMSVYKNESFVVTGHQSGVILLHRLREGSIGEDLNSAVMENVGKFDGTEDGLQVTL
LEVHHVGRVRYILATDLSGKLTVFTENRTVYGSVSPTSRPLVFLKQRLLFLTETGAGSLD
LRSMKIRESECEGLNHSLARSYVFDASERAKAYGFTSEGEIIHVLLLGDIMNFKCRVRSK
KKVQMEEPVALQAIKGYLLIVNQEKVFVYNVSTQHYVRTTGPRLLFPAALEDIRSTFLSH
RESTKTTDHQKLEKVTPLIASDREKLLVMGLGDGYVATYKSKLPISKAEFNTMLWSSPVF
FFILFLFGAWHFFSKKKESLTAWGPDDPFSSTTMSSSSTTTAQNSSAFSESTRRNDDHMD
LRRRYVSPSRYPPGAATGAYRSVGSNDPSSRAPVETTNYRTTAQEMKYRGGSGLDSGGFG
KRRESLFGNNKALDDES

www.000webhost.com

Other information
Ka divergence:-0.134766KaKs divergence:0.343861
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1818Length 2 (bp):1854Length divergence:0.01
MFE 1 (kcal):-550.91MFE 2 (kcal):-570.2MFE divergence0.017