Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19400-AT1G75180
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Erythronate-4-phosphate dehydrogenase family protein
Function (paralog2):Erythronate-4-phosphate dehydrogenase family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.23119167333155
Log2 mRNA fold difference:0.22683916803093
Log2 TE fold difference:-0.47215093698278
Sequences
Protein sequence

MEEPCETLDSGEAYQISRYHNYNQHSSRSSSPWLDLRVFYVRISNFVVEDSTPEVLTINH
IPLDPDTLLEINGVRMGMYSEGGSSQLRRDRVDKKSEEATYVSTDNIRLTGSVKFEVYDK
NELVLSGTLEMSGSNGFTGESKNRWKMNCEAEVTAGSGFLKEKSINGQELSSPLPTIEVY
VTGCFSGTPIILTKTLQLGLKKKQSRRMALDAIPEYETAEPQKDTSYALDLQATTEYGNY
KEEYEGDMYWRSECIDGEMSWFNAGVRVGVGIGLGVCVGLGIGVGLLVRTYQSTTRTFRR
RLL

MVEPYETRNNGEASQMIRYQSYNHHNSRLPSSLSSPLLDLRVFYVRISNFKVDHSTPEVL
TITHIPLDPDSLLEINGVRMSMYSEGVSSQLRRDRVDKKSEVATFISTDNIRLSGSVKFE
VYDKDELVLSGTLEMSGSNGFTGESKHSVKRWNMNCEAEITAESGFLKEKHIGGSELSSP
LPTIEVYVTGCFSGTPIILTKTLQLGFRKKHGRVTALDSIPEYETDEPHKGNSSELDYQV
TEYGSYKQEYEGEHSDMYWNREYADGEDGEMSWFNAGVRVGVGIGLGVCVGLGIGVGLLV
RTYQSTTRNFRRRII

www.000webhost.com

Other information
Ka divergence:0.100736KaKs divergence:-0.187618
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):912Length 2 (bp):948Length divergence:0.019
MFE 1 (kcal):-274.8MFE 2 (kcal):-289.6MFE divergence0.026