Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19450-AT1G75220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Major facilitator superfamily protein
Function (paralog2):Major facilitator superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.3115719651519
Log2 mRNA fold difference:1.4916374932147
Log2 TE fold difference:-0.087807587209845
Sequences
Protein sequence

MSFRDDNTEEGRNDLRRPFLHTGSWYRMGSRQSSMLESSQVIRDSSISVLACVLIVALGP
IQFGFTCGYSSPTQAAITKDLGLTVSEYSVFGSLSNVGAMVGAIASGQIAEYVGRKGSLM
IAAIPNIIGWLSISFAKDTSFLYMGRLLEGFGVGIISYTVPVYIAEIAPQTMRGALGSVN
QLSVTIGIMLAYLLGLFVPWRILAVLGVLPCTLLIPGLFFIPESPRWLAKMGLTDDFETS
LQVLRGFETDITVEVNEIKRSVASSSKRSAVRFVDLKRRRYYFPLMVGIGLLALQQLGGI
NGVLFYSSTIFESAGVTSSNVATFGVGVVQVVATGIATWLVDKAGRRLLLMISSIGMTIS
LVIVAVAFYLKEFVSPDSNMYNILSMVSVVGVVAMVISCSLGMGPIPWLIMSEILPVNIK
GLAGSIATLLNWFVSWLVTMTANMLLAWSSGGTFTLYALVCGFTVVFVSLWVPETKGKTL
EEIQALFR

MSFRDDNEEARNDLRRPFIHTGSWYRMGSRQSSMMGSSQVIRDSSISVLACVLIVALGPI
QFGFTCGYSSPTQAAITKDLGLTVSEYSVFGSLSNVGAMVGAIASGQIAEYIGRKGSLMI
AAIPNIIGWLCISFAKDTSFLYMGRLLEGFGVGIISYTVPVYIAEIAPQNMRGGLGSVNQ
LSVTIGIMLAYLLGLFVPWRILAVLGILPCTLLIPGLFFIPESPRWLAKMGMTDEFETSL
QVLRGFETDITVEVNEIKRSVASSTKRNTVRFVDLKRRRYYFPLMVGIGLLVLQQLGGIN
GVLFYSSTIFESAGVTSSNAATFGVGAIQVVATAISTWLVDKAGRRLLLTISSVGMTISL
VIVAAAFYLKEFVSPDSDMYSWLSILSVVGVVAMVVFFSLGMGPIPWLIMSEILPVNIKG
LAGSIATLANWFFSWLITMTANLLLAWSSGGTFTLYGLVCAFTVVFVTLWVPETKGKTLE
ELQSLFR

Other information
Ka divergence:-0.0906355KaKs divergence:0.104681
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):1467Length 2 (bp):1464Length divergence:-0.001
MFE 1 (kcal):-451.5MFE 2 (kcal):-456.82MFE divergence0.006