Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19480-AT1G75230
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNA glycosylase superfamily protein
Function (paralog2):DNA glycosylase superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.84132393709055
Log2 mRNA fold difference:0.391717473856
Log2 TE fold difference:0.55500068848611
Sequences
Protein sequence

MGEQSPSQPSTQCQSHPQSPKPDTHNLIPPESTDECLDSAGVSGSIVSSTTIDARRITEL
GNVSSPPSKIPLRPRKIRKLTLDGDVSGEDYKAEDISSSQVNSPLATDGKSPGKGKLSHL
RAITVPRIQARPLTCEGELETAIHYLRNADPLLAALIDVHPPPTFESFKTPFLALIRNIL
YQQLAMKAGNSIYTRFVSLCGGENLVVPETVLSLNPQQLRQIGVSGRKASYLHDLARKYQ
NGILSDSAILNMDEKSLFTMLTMVNGIGSWSVHMFMINSLHRPDVLPVNDLGVRKGVQLL
YGLDDLPRPSQMEQHCAKWRPYRSVGSWYMWRLIEAKSTSTSAAVAAGVSLPPLEDIQQE
HQQQQLMDPLNGVFSIGAWGQS

MGEHSPSQPSSHTLPPNQPESPNHETPNPIPPETNDDDSASSAGVSGSIVSSTTIEAPQV
TELGNVSSPPTKIPLRPRKIRKLSPDDDASDGFNPEHNLSQMTTTKPATKSKLSQSRTVT
VPRIQARSLTCEGELEAALHHLRSVDPLLASLIDIHPPPTFETFQTPFLALIRSILYQQL
AAKAGNSIYTRFVALCGGENGVVPENVLPLTPQQLRQIGVSGRKASYLHDLARKYQNGIL
SDSGIVNMDEKSLFTMLTMVNGIGSWSVHMFMINSLHRPDVLPVNDLGVRKGVQMLNGME
DLPRPSKMEQLCEKWRPYRSVASWYLWRLIESKNTPPNAAAATAGAALSFPQLEDIQQQE
QEQQHQQHQQQQPQLMDPLNNVFSIGYSQLHCAT

www.000webhost.com

Other information
Ka divergence:-0.0750991KaKs divergence:0.0874266
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1149Length 2 (bp):1185Length divergence:0.015
MFE 1 (kcal):-358.51MFE 2 (kcal):-341.06MFE divergence-0.025