Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19570-AT1G75270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):dehydroascorbate reductase
Function (paralog2):dehydroascorbate reductase 2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-6.055807878147
Log2 mRNA fold difference:-5.8005370228547
Log2 TE fold difference:-0.34159852885374
Sequences
Protein sequence

MALEICVKAAVGAPDHLGDCPFSQRALLTLEEKSLTYKIHLINLSDKPQWFLDISPQGKV
PVLKIDDKWVTDSDVIVGILEEKYPDPPLKTPAEFASVGSNIFGTFGTFLKSKDSNDGSE
HALLVELEALENHLKSHDGPFIAGERVSAVDLSLAPKLYHLQVALGHFKSWSVPESFPHV
HNYMKTLFSLDSFEKTKTEEKYVISGWAPKVNP

MALDICVKVAVGAPDVLGDCPFSQRVLLTLEEKKLPYKTHLINVSDKPQWFLDISPEGKV
PVVKLDGKWVADSDVIVGLLEEKYPEPSLKTPPEFASVGSKIFGAFVTFLKSKDANDGSE
KALVDELEALENHLKTHSGPFVAGEKITAVDLSLAPKLYHLEVALGHYKNWSVPESLTSV
RNYAKALFSRESFENTKAKKEIVVAGWESKVNA

www.000webhost.com

Other information
Ka divergence:-0.394959KaKs divergence:-0.363779
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):642Length 2 (bp):642Length divergence:0
MFE 1 (kcal):-191.3MFE 2 (kcal):-202.8MFE divergence0.029