Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19650-AT1G75370
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Sec14p-like phosphatidylinositol transfer family protein
Function (paralog2):Sec14p-like phosphatidylinositol transfer family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.9506437520116
Log2 mRNA fold difference:0.91581612479422
Log2 TE fold difference:1.0539249943531
Sequences
Protein sequence

MSGPLDRFTSPCFSNNGEKREKKSDFEVSEDEKKTRIGGILKKKSSKSKFRHSLKRRGSR
SIDRTLSLTFEDIHDAEELRYVSEFRQSLISDHLLPPNLDDYHIMLRFLFARKFDLGKAK
LMWTNMIQWRRDFGTDTILEDFEFPELDEVLRYYPQGYHGVDKEGRPVYIERLGKVDASK
LMQVTTLERYLRYHVKEFEKTITVKFPACCIAAKRHIDSSTTILDVQGLGLKNFTKTARD
LIIQLQKIDSDNYPETLHRMFIINAGSGFKLLWGTVKSFLDPKTVSKIHVLGNKYQNKLL
EMIDASQLPDFFGGTCTCADQGGCMRSDKGPWKDSEILKMGRSGGTFCRHAGAFLSSDSQ
ISSSDKPTYSLKVSDTSTAKSGSELEEMASPKTNTNNHVPKLTPVSEYANGNISPTVLSE
YEECVPMVDKVVDVAWQLQEMPNASEGPQYTSSLGKIGSVRHIWSWLTAFFISFFTLLAS
LALPQTKEHSQLHSSSVRAELCDERIARESRPPSPPRSTITERVIISSVLSRLGDLEKQI
ENLHSRKSEMPHEKEELLNAAVYRVDALEAELITTKKALHEALIRQEELLGYIDRQKEAK
CRRKKFCW

MSGSLDRFARPCFEGVSSNDERRERRSDFEVSEDEKKTRIGNFNFKKKAAKASSKLRHSL
KKKGSSRRRSSDRTFSLTIEDIHDVEELRAVDEFRNLLVSENLLPPTLDDYHIMLRFLKA
RKFDIGKTKLMWSNMIKWRKDFGTDTIFEDFEFEEFDEVLKYYPHGYHGVDKEGRPVYIE
RLGLVDPAKLMQVTTVERFIRYHVREFEKTVNIKLPACCIAAKRHIDSSTTILDVQGVGF
KNFSKPARDLIIQLQKIDNDNYPETLHRMFIINGGSGFKLVWATVKQFLDPKTVTKIHVI
GNKYQNKLLEIIDASQLPDFLGGTCTCADRGGCMRSDKGPWNDPEILKMLQSGGPLCRHN
SALNSFSRVSSCDKPSFSGIKASDTSTAESGSEVEEMASPKVNRELRVPKLTPVCEDIRG
TAISYPTDSSEYDSPMVDKVVDVAWMAHEKPKASKGSEDTPDSGKIRTVTYIWRWLMMFF
VNLFTLLISLALPQREGHSQSESSVDGPNARESRPPSPAFATIAERNVFSSVVNRLGDLE
KQVETLHSKRHEMPREKEELLNTAVYRVDALEAELIATKKALHEALMRQDDLLAYIDREE
DEKYHKRIHLRGFCWENRKRRFVNTNPIERTMFISKIRSHKQRFDTFGGNFRRMFFQLIF
KVHFYLYQ

www.000webhost.com

Other information
Ka divergence:-0.00352702KaKs divergence:0.016288
GC content 1 (%):42GC content 2 (%):40GC content divergence:-0.024
Length 1 (bp):1827Length 2 (bp):2007Length divergence:0.047
MFE 1 (kcal):-524.2MFE 2 (kcal):-559.94MFE divergence0.033