Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19660-AT1G75380
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Wound-responsive family protein
Function (paralog2):bifunctional nuclease in basal defense response 1

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.40904180737067
Log2 mRNA fold difference:-0.2862345465036
Log2 TE fold difference:0.47834055853147
Sequences
Protein sequence

MRSLQAPVVCPSVRPRQLGVSALLVNCSVSKTRSLRKQFWGNQTKNDKSQAATVNLRLHL
RRYKSIKCLFSSHSDGTGSTAENFNENDEDYVKSSVLEAVEVKSGPDGFMVKMKDGRQLR
CVHNNPQGGNLPNYAPHSAIVLKMEDGTGLLLPIIVLEMPSVLLMAAMTNVQIARPTMYQ
VVKDMVDKMGYEVRLVRVTTRVHEAYFAELYLSKVGDKSDCVSFDLRPSDAINIAVRCKV
PIQVNKYLAYSDGMRVIDSGKLSKQTPASDGLLFTELDRPNGQPCFDTKEFDLVRNMMQA
VDEERYDEAAEWRDKLGKFQAKRKLRKYT

MRSVQAPVVCPAIRPRQVGACASLVNYTGLKPRSQFWGNRTKGVKSQGTTTTITLRLCNK
SIKCVFSSHSDGNGSTAENFNENDEEYVNSSVVEAVEVKSGADGFMVKMRDGRQLRCVHN
NPQGGHLPDYAPHPAIVLKMEDGTGLLLPIIVLEMPSVLLMAAMTNVQIARPTMYQVVKE
MVDKMGYEVRLVRVTKRVHEAYFAQLFLSKVGNASECVSFDLRPSDAINIAVRCKIPIQV
NKYLAYSDGMRVIESGKISTPAPASDGLLFTEQDRPNGQACLDTKEFNILSKMMQAVDEE
RYDEAAEWRDKLGQFRAKRNLRKYT

Other information
Ka divergence:-0.187757KaKs divergence:0.0988942
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):990Length 2 (bp):978Length divergence:-0.006
MFE 1 (kcal):-289.4MFE 2 (kcal):-291.6MFE divergence0.004