Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19680-AT1G75400
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.201560792531
Log2 mRNA fold difference:-0.82077847858793
Log2 TE fold difference:2.0510262523152
Sequences
Protein sequence

MGSVCCVAAKDRNVPSGAIDNSVCSPSWSFRRDNRRRVADEIKDSSNHNVGSRGIDIDKL
SLGLERGPPSSETGGLATLGSQKSADSEMGTASMVTAPLAGTSLAIRSPSDVSLASPVRV
EVKNIVDSSDIVSSVLPNPSSSTSVSDLPSAHTHSLPPRSTPSRRARGSPGQQLFRQVSD
SQTLGLKSPNNYSTSEGRSSFVLSTCSNDTATGSHFASSEGGWSINAFCELVAQSQRERW
SFDNEHLGSGRRRLSGCSSSRFSCSPSVDQQTCGRCSKLLTERSPVARFDLPIPAVLACG
HVYHAACLETMTNETEKYDPTCPICTETQVTKLSRKALKAEAELKATSYKRCKNRVVDSY
VRSECEDLMFQNLGKREGKGLKMDPSSNTKGSTSKSFMKWHFGSVSTKWSKARDSTSKKS
FWSRHSNKRLSHSFSSVEGLNQAT

MGSVCCVAVKDRKVPPSGGPASSSVHRNSACSPQWSFRRDNRRRVADEIEGSPYYSPYVA
SRGISMDKMSLGSERGTLSEGGTPPDGHLGTPASQKSATPEMSTNSMVPPSSGSSLASSD
LIEVKNLVDSPGIVPSAQSKPLFSTPSLPNPVSDLSSAHTRLLPPKSTPSRRARRSPGHQ
LFRQVSDSQILGLKSPINNYSISEGRSSFVLSTCSNDFATGSQYASSEGGWSMNTFSELV
AYSQRDRWSFDSEHLGSGRRKLSGGSSRFSFSPSVVDQQVCGACSKLLTERSSIATFELP
IAAVLACGHVYHAECLETMTTDIEKYDPACPICTIGEKRVAKITRKALKAEAEAKAKQYK
RCKNRVVDSYGESECDEFVFQKMGKREGKALKLEASCSSKSSSNKSFLKWHFASISSKWN
KPSSKDSALKKGFWSRHRNNRSSSSIEGLNQTSPL

www.000webhost.com

Other information
Ka divergence:-0.359776KaKs divergence:-0.839818
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1335Length 2 (bp):1368Length divergence:0.012
MFE 1 (kcal):-412.7MFE 2 (kcal):-429.88MFE divergence0.02