Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19710-AT1G75420
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):UDP-Glycosyltransferase superfamily protein
Function (paralog2):UDP-Glycosyltransferase superfamily protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:1.0799282519493
Log2 mRNA fold difference:0.64392229078718
Log2 TE fold difference:0.5496472582884
Sequences
Protein sequence

MAKPSTSMWATLQKKRWPLMILLVLSVSTVGMILVRSTFDSCSVSGKRCSREKEDNSDIK
IQSVSGSLNPLEFMKSKLVLLVSHELSLSGGPLLLMELAFLLRGVESEVVWITNQKPVEE
DEVIKVLEHKMLDRGVQVISAKSQKAIDTALKSDLVVLNTAVAGKWLDAVLKDNVPKVLP
KVLWWIHEMRGHYFKPDLVKHLPFVAGAMIDSHATAEYWKNRTHDRLGIKMPKTYVVHLG
NSKELMEVAEDSFAKNVLREQVRESLGVRNEDILFGIINSVSRGKGQDLFLRAFHESLKV
IKETKKLEVPTMHAVVVGSDMSAQTKFETELRNFVQEMKLQKIVHFVNKTMKVAPYLAAI
DVLVQNSQARGECFGRITIEAMAFKLPVLGTAAGGTMEIVVNRTTGLLHNTGKDGVLPLA
KNIVKLATNVKMRNTMGKKGYERVKEMFLEHHMSHRIASVLREVLQHAKIHSRTTNSDH

MVKASTMQRKRWALMVLLFLSVSTVCMILVRSSFETCSISSQFVEEKNGESSAAKFQSNP
LDFMKSKLVLLVSHELSLSGGPLLLMELAFLLRGVGADVVWITNQKPLEDDEVVYSLEHK
MLDRGVQVISAKGQKAVDTSLKADLIVLNTAVAGKWLDAVLKENVVKVLPKILWWIHEMR
GHYFNADLVKHLPFVAGAMIDSHATAGYWKNRTQARLGIKMPKTYVVHLGNSKELMEVAE
DSVAKRVLREHVRESLGVRNEDLLFGIINSVSRGKGQDLFLRAFHESLERIKEKKLQVPT
MHAVVVGSDMSKQTKFETELRNFVREKKLENFVHFVNKTLTVAPYIAAIDVLVQNSQARG
ECFGRITIEAMAFKLPVLGTAAGGTMEIVVNGTTGLLHSAGKEGVIPLAKNIVKLATQVE
LRLRMGKNGYERVKEMFLEHHMSHRIASVLKEVLQHAKARALR

www.000webhost.com

Other information
Ka divergence:-0.000694927KaKs divergence:-0.0781121
GC content 1 (%):41GC content 2 (%):43GC content divergence:0.024
Length 1 (bp):1440Length 2 (bp):1392Length divergence:-0.017
MFE 1 (kcal):-406.45MFE 2 (kcal):-408.3MFE divergence0.002