Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19740-AT1G75460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ATP-dependent protease La (LON) domain protein
Function (paralog2):ATP-dependent protease La (LON) domain protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.29696685835475
Log2 mRNA fold difference:-0.88313570692103
Log2 TE fold difference:0.56637545455661
Sequences
Protein sequence

MALPSTVSSPSFKSTPPYLSAFNPKPLHLPATYRSINRRSCKLLSFRCSSSSFSEKHHNN
ANPPKSDDLVELPLFPLPLVLFPGATIPLQIFEFRYRVMMQTLLQSDLRFGVVYSDAVSG
SAAGIGCVGEIVKHERLVDDRFFLICKGQERFRVTDLVRTKPYLVAKVTWLEDRPSGEEN
LDELANEVEVLMKEVIRLSNRLNGKPDKESQDLRKNQFPTPFSFFVGSTFEGAPMEQQAL
LELEDTAARLKRERETLRNTLNYLTAASAVKDVFPSQP

MALPHVVSSPSSTSLSPSFKSKPPFHSLRSLSPTVDNRRRCKLNSSFRCSSSSFSEKHHN
AKSPKSDDIVELPLFPLPLVLFPGAILPLQIFEFRYRIMMHTLLQSDLRFGVVYSDSVSG
SAAEVGCVGEVVKHERLVDDRFFLVCKGQERFRVTNVVRTKPYLVGEVTWLEDRPSGEEN
LDSLANEVEVLMKEVIRLSNRLNGKAEKEVQDLRRNQFPTPFSFFVGSTFEGAPREQQAL
LELEDTAARLKRERETLRNTLNYLTAASAVKDVFPSSS

Other information
Ka divergence:-0.165248KaKs divergence:0.0749251
GC content 1 (%):49GC content 2 (%):45GC content divergence:-0.043
Length 1 (bp):837Length 2 (bp):837Length divergence:0
MFE 1 (kcal):-262.1MFE 2 (kcal):-234.09MFE divergence-0.056