Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19790-AT1G75520
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SHI-related sequence 7
Function (paralog2):SHI-related sequence 5

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.5988805924091
Log2 mRNA fold difference:2.4813421012237
Log2 TE fold difference:-1.0353643584566
Sequences
Protein sequence

MAGLFYLGGRDHNKQDHHQEKDHNEDKSNNYLYLYKDEIYNNNKGFEIFPPQYFQQQQQQ
NHAAAPTNLYSFGMVPSGGNINNNRSTNRSLYFNVVSDHEPVRSSTGGFTVTRQGNMNCQ
DCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVSAAKRRERQAQLAVLPAKRIRDANS
RGGGDDDDDDKEDEKNDSCGGGSALACTRVVNASSSGLETSHLPPEISSPAVFRCMRVSS
IDDEDEEYAYQTAVSIGGHVFKGILYDQGPSSDHHRYSSSLNGETSHQHHLNLMDSTPSA
ATTNAVTAVNTNNGSIDPSSLYTAVATPFNAFVAGGTPFFASSRC

MAGFFYLGGRDNNSNNNKQDHHQVDKDHHHQDKSNYLYLYKDEIYNNNKGFEIWPPQYFQ
QQEHQQQQQQQQHASAPANFYSFGMVPSGSSSNNNNNRSRSLYFNVVSDHEPGGFTVTRQ
GGMNCQDCGNQAKKDCPHMRCRTCCKSRGFHCQTHVKSTWVPAAKRRERLAQLASLQHHS
ASSRETQNAKRLREASGGDNNDDKDHSGGGGSALANTRVVNANSNSGLEVSQHLPPEVNS
PAIFRCVRVSSIEEDEDDQAYAYQTAVNIGGHIFKGILYDQGPEHQDNHHLNLLASTATT
TNVEETATKTVTGNNNNGLMLDPSSLYPAQLNSFIAGTPFFTPPRS

www.000webhost.com

Other information
Ka divergence:-0.139527KaKs divergence:0.111567
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):1038Length 2 (bp):1041Length divergence:0.001
MFE 1 (kcal):-315.49MFE 2 (kcal):-295.12MFE divergence-0.033