Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19830-AT1G75580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SAUR-like auxin-responsive protein family
Function (paralog2):SAUR-like auxin-responsive protein family

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.4533855007582
Log2 mRNA fold difference:2.0367080787581
Log2 TE fold difference:0.66760804613192
Sequences
Protein sequence

MAIINRSKLTQTTMIKQILKRCSSLGKKQSSEYNDTHEHDGDSLPLDVPKGHFVVYVGGN
RVRYVLPISFLTRPEFQLLLQQAEEEFGFDHNMGLTIPCEEVAFKSLITSMLQPTYI

MAMKKANKLTQTAMIKQILKRCSSLGKKQSNVYGEDENGSPLNVPKGHFVVYVGENRVRY
VVPISFLTRPEFQLLLQQAEEEFGFDHDMGLTIPCEEVVFRSLTSMLR

www.000webhost.com

Other information
Ka divergence:-0.558993KaKs divergence:0.999706
GC content 1 (%):44GC content 2 (%):47GC content divergence:0.033
Length 1 (bp):354Length 2 (bp):327Length divergence:-0.04
MFE 1 (kcal):-107.9MFE 2 (kcal):-98MFE divergence-0.048