Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19840-AT1G75590
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SAUR-like auxin-responsive protein family
Function (paralog2):SAUR-like auxin-responsive protein family

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.998570659682
Log2 mRNA fold difference:-3.3941358730297
Log2 TE fold difference:0.40827940017194
Sequences
Protein sequence

MAGSLVKCSKIRHIVRLRQMLRRWRNKARLSSVSRCVPSDVPSGHVAVCVGSGCRRFVVR
ASYLNHPIISNLLVQAEEEFGFANQGPLVIPCEESVFEEAIRFISRSDSSRSSRFTCPDD
LQKCNGGIKIKSKLDLMIESRPLLHGVAEKAIW

MAGGLGKCSKIRHIVRLRQMLRRWRDQARMSSSFSRCVPSDVPSGHVAVYVGSSCRRFVV
RATYLNHPVLRNLLVQAEEEFGFVNQGPLVIPCEESVFEESIRFISRSDSTRSRRFTCPD
DFQKNCHVVGIRSKLDLWIESRPLLHGVTEKAVW

Other information
Ka divergence:-0.272946KaKs divergence:0.999742
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):462Length 2 (bp):465Length divergence:0.003
MFE 1 (kcal):-148.6MFE 2 (kcal):-156.84MFE divergence0.027