Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19900-AT1G75620
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glyoxal oxidase-related protein
Function (paralog2):glyoxal oxidase-related protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.980637664763
Log2 mRNA fold difference:-2.6228199469488
Log2 TE fold difference:0.80937131836248
Sequences
Protein sequence

MAARATFIFYALFLTTLQFLLTHHVSSAARGLWKYIAPNVGISAMHMQLLHNDRVVMYDR
TNFGPSNISLPNGNCRDNPQDAVSKIDCTAHSIEYDVATNTIRPLTVQSNTWCSSGSVRP
DGVLVQTGGDRDGELKTRTFSPCNNNQCDWVEMNNGLKKRRWYASNHILPDGKQIVMGGQ
GQFNYEFFPKTTNPNVVALPFLAETHDQGQENNLYPFVFMNTDGNLFMFANNRAILLDYV
KNTVVKTFPAIPGGDPRNYPSTGSAVLLPLKNLEADNVETEVLVCGGAPKGSYNLARKKT
FVKALDTCARIKINDAKPEWAVEKMPHARVMGDMIPLPNGDVLLINGGSFGTAAWELGRT
PVLAPDLYHPENPVGSRFESLRPTTIPRMYHSAAILLRDGRVLVGGSNPHAFYNYTGVLF
PTELSLEAFSPVYLQREFSNLRPKIISPEPQSMIKYGTNLKLKFSVTGEVTTPAKVTMVF
PTFTTHSFAMNQRVLVLDNVKFTRKGKSPMYEVQVRTPRSANIAWPGYYMIFVVNQDIPS
EGVWVKLE

MAAKATTQIVSDVNHLRYFAVFFLLSCHVASGDEGTWELLLPNVGISAMHSQLLHNDRVI
MYDRTNFGPSNISLPNGACRSSPGDAVSKTDCTAHSVEYDVALNRIRPLTVQSNTWCSSG
GVTPDGTLLQTGGDLDGERKVRLMDPCDDNSCDWIEVDNGLAARRWYATNHILPDGRQII
IGGRGQFNYEFFPKTNAPNFYSIPFLSETNDPGDENNLYPFVFLNTDGNLFIFANNRAIL
LDYSTNTVVRTYPEIPGGDPRSYPSTGSAVLLPIKNLVLEVLVCGGAPKGSYNLSWRNTF
VKALDTCARININDVNPQWIVEKMPRARVMGDMMLLPDGNVLLINGGSSGTAAWELGREP
VLHPDLYHPDKPVGSRFEVQNPSTIPRMYHSIATLLRDGRILVGGSNPHAFYNFTGVLFP
TELRLEAFSPSYLDTKYSSLRPSIVDPRPQTTVNYGRVLRLRFIVSGRVKSPVKVTMLFP
SFTTHSFSMHQRLLVLDHVISFKLGISKIYEVRVRTPSSAILAPPGYYMVFVVNQDIPSE
GLWVRLQ

www.000webhost.com

Other information
Ka divergence:-0.0545041KaKs divergence:-0.338606
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1647Length 2 (bp):1644Length divergence:-0.001
MFE 1 (kcal):-510.25MFE 2 (kcal):-501.89MFE divergence-0.008