Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19910-AT1G75630
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ATPase, F0/V0 complex, subunit C protein
Function (paralog2):vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.7003725088019
Log2 mRNA fold difference:-1.6954579839076
Log2 TE fold difference:-0.027959352767402
Sequences
Protein sequence

MASTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV
MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG
VRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAE

MASSGFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPV
VMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDA
GVRVVDCNPDSKIKIYSFTTSFLSNLSQKELFIDLLSANAQQPKLFVGMILILIFAEALA
LYGLIVGIILSSRAGQSRAE

www.000webhost.com

Other information
Ka divergence:0.332969KaKs divergence:-0.999961
GC content 1 (%):49GC content 2 (%):46GC content divergence:-0.032
Length 1 (bp):498Length 2 (bp):603Length divergence:0.095
MFE 1 (kcal):-166.7MFE 2 (kcal):-191.91MFE divergence0.07