Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19940-AT1G75680
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glycosyl hydrolase 9B5
Function (paralog2):glycosyl hydrolase 9B7

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:5.7962105798407
Log2 mRNA fold difference:5.7774691848276
Log2 TE fold difference:0.019340453428433
Sequences
Protein sequence

MVAKPRSRCCCCSVFIGVIILIAIIIAVIFTIRHRSNHSDDDGSNVKNYANALKIAMQFF
DIQKSGKLENNEISWRGDSGLKDGSEASIDLSKGLYDAGDHMKFGFPMAFTATVLSWSIL
EYGDQMASLNLLDHAKDSLKWTTDFLINAHPSPNVLYIQVGDPVTDHKCWDRPETMTRKR
TLTKIDTKTPGTEVAAETAAAMAAASLVFKESDTKYSSTLLKHAKQLFDFADNNRGSYSV
NIPEVQSYYNSTGYGDELLWAASWLYHATEDQTYLDFVSENGEEFGNFGSPSWFSWDNKL
PGTHILLSRLTFFKKGLSGSKGLQGFKETAEAVMCGLIPSSPTATSSRTDGGLIWVSEWN
ALQHPVSSAFLATLYSDYMLTSGVKELSCSDQSFKPSDLRKFARSQADYMLGKNPEKMSY
LVGYGEKYPEFVHHRGASIPADATTGCKDGFKWLNSDEPNPNVAYGALVGGPFLNDTFID
ARNNSMQNEPSTYNSALVVGLLSSLVTTSSSVESF

MEEKSKSRGWCGWFIAIIVLASVILAVVYTVKLRTKKSGDDDGGGPVPGPPGAIDKKYAD
ALKLALQFFDIQKSGKLENNKIPWRGDSGLKDGSEDNLDLSKGLYDAGDHIKFGFPMAFT
ATVLSWSILEYGDQMNAVNQLDPAKDSLRWITDYLIKAHPSDNVLYIQVGDPKVDHPCWE
RPEDMKEKRPLTKIDVDTPGTEVAAETAAAMASASLVFKDSDPTYSATLLKHAKQLFNFA
DTKRGSYSVNIPEVQKFYNSTGYGDELLWAASWLYHATEDKTYLDYVSNHGKEFASFGNP
TWFSWDNKLAGTQVLLSRLLFFKKDLSGSKGLGNYRNTAKAVMCGLLPKSPTSTASRTNG
GLIWVSEWNSMQQSVSSAFLASLFSDYMLTSRIHKISCDGKIFKATELRDFAKSQADYML
GKNPLGTSFVVGYGDKYPQFVHHRGASIPADATTGCLDGFKWFNSTKPNPNIAYGALVGG
PFFNETFTDSRENPMQNEPTTYNNALLVGLLSSLVTTSSTLQSLK

www.000webhost.com

Other information
Ka divergence:0.0359508KaKs divergence:0.364685
GC content 1 (%):40GC content 2 (%):43GC content divergence:0.036
Length 1 (bp):1548Length 2 (bp):1578Length divergence:0.01
MFE 1 (kcal):-442.06MFE 2 (kcal):-503.21MFE divergence0.065