Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G19970-AT1G75760
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ER lumen protein retaining receptor family protein
Function (paralog2):ER lumen protein retaining receptor family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.1731973914835
Log2 mRNA fold difference:0.65071028956663
Log2 TE fold difference:1.1732268207344
Sequences
Protein sequence

MKAEKNPIQSVMAWIRRQPPKVKAFLGVVTAMTVLVLLRVIVHEHDNLFVASEAVHAVGI
AVLIYKLTKEKTCAGISLKTQELTALFLAVRLYCSFVMEFDLHTFLDSATLVTTLWVVYM
IRFKLRPTYMEDKDNFAIYFVVIPCAVLSFFIHPSTRHHIINRISWAFCVYLEAVSVLPQ
LRVMQNTKIVEPFTAHYVFALGIARFLSCAHWILQVLDTRGRLLTALGSGLWPVMVLISE
IVQTFILADFCYYYVQSLMGGQLVLRLPSGVV

MKAATRPIHAVTTWVRRQPPKVKGFLGVVSAMTALVLLRVIVHDHDNLFVAAEAVHSLGI
SVLIYKLTKERTCAGLSLKSQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTLFVIYM
IRFKLKASYMDDKDNFAIYYVVIPCVVLSVLIHPSTHHHIINKISWAFCVYLEAVSVLPQ
LRVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDTRGRLLTALGYGFWPIMVLLSE
IVQTFILADFCYYYVKSLMGGQLVLRLPSGVV

www.000webhost.com

Other information
Ka divergence:-0.353742KaKs divergence:-0.311756
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):819Length 2 (bp):819Length divergence:0
MFE 1 (kcal):-237.98MFE 2 (kcal):-226.84MFE divergence-0.024