Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20010-AT1G75780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):tubulin beta-5 chain
Function (paralog2):tubulin beta-1 chain

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.8676081513836
Log2 mRNA fold difference:-2.8358386970229
Log2 TE fold difference:0.92450911798199
Sequences
Protein sequence

MREILHIQGGQCGNQIGSKFWEVICDEHGIDSTGRYSGDTADLQLERINVYYNEASGGRY
VPRAVLMDLEPGTMDSIRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDV
VRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTV
VEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLNHLISATMSGVTCS
LRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYISLTVPELTQQMWDSKNM
MCAADPRHGRYLTASAIFRGQMSTKEVDEQILNIQNKNSSYFVEWIPNNVKSSVCDIPPK
GLKMAATFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV
AEYQQYQDATADEEGEYDVEEEEEGDYET

MREILHVQGGQCGNQIGSKFWEVICDEHGVDPTGRYNGDSADLQLERINVYYNEASGGRY
VPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDV
VRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTV
VEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLSTPSFGDLNHLISATMSGVTCS
LRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYISLTVPELTQQMWDAKNM
MCAADPRHGRYLTASAMFRGKMSTKEVDEQILNVQNKNSSYFVEWIPNNVKSSVCDIPPT
GIKMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLV
SEYQQYQDATADEEDEYDEEEEQVYES

Other information
Ka divergence:-0.557236KaKs divergence:-0.501006
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1350Length 2 (bp):1344Length divergence:-0.002
MFE 1 (kcal):-432.15MFE 2 (kcal):-393.91MFE divergence-0.046