Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20030-AT1G75800
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pathogenesis-related thaumatin superfamily protein
Function (paralog2):Pathogenesis-related thaumatin superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:2.9522833910783
Log2 mRNA fold difference:2.8968421810671
Log2 TE fold difference:0.0048414871235748
Sequences
Protein sequence

MALTFFFLLSNLFFSGVMSRSFTFSNKCDYTVWPGILSNAGVSPLPTTGFVLLKGETRTI
NAPSSWGGRFWGRTLCSTDSDGKFSCATGDCGSGKIECSGAGAAPPATLAEFTLDGSGGL
DFYDVSLVDGYNVQMLVVPQGGSGQNCSSTGCVVDLNGSCPSELRVNSVDGKEAVAMACK
SACEAFRQPEYCCSGAFGSPDTCKPSTYSRIFKSACPRAYSYAYDDKSSTFTCAKSPNYV
ITFCPSPNTSLKSAEEHSTETMTTTSPSSGSTTSSQMVYEGALDESSGSPSTYHGVSRAI
TVVLLSLAFCRMWWFF

MALPLPLIFLIFSHLFVSGVRSTSFIMVNKCEYTVWPGLLSNAGVPPLPTTGFVLQKGEE
RTISAPTSWGGRFWGRTQCSTDTDGKFTCLTGDCGSGTLECSGSGATPPATLAEFTLDGS
NGLDFYDVSLVDGYNVPMLVAPQGGSGLNCSSTGCVVDLNGSCPSELKVTSLDGRGKQSM
GCKSACEAFRTPEYCCSGAHGTPDTCKPSSYSLMFKTACPRAYSYAYDDQSSTFTCAESP
NYVITFCPTPNTSQKSSQDQSPDPKPTTPTGTSSTTPAGDSSTTWSPVDTSMIYEGALDQ
NKGSPSTCHLSLCGITVTLALAFCRMWRLF

www.000webhost.com

Other information
Ka divergence:0.081625KaKs divergence:0.0470246
GC content 1 (%):53GC content 2 (%):49GC content divergence:-0.039
Length 1 (bp):951Length 2 (bp):993Length divergence:0.022
MFE 1 (kcal):-326.12MFE 2 (kcal):-316.96MFE divergence-0.014