Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20090-AT1G75840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RHO-related protein from plants 2
Function (paralog2):RAC-like GTP binding protein 5

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:0.50862921719214
Log2 mRNA fold difference:-0.87586654534101
Log2 TE fold difference:1.3874286846076
Sequences
Protein sequence

MASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDT
AGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLD
LRDDKQFFIDHPGAVPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVLQPP
KQKKKKKNKNRCAFL

MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD
TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL
DLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPIYIECSSKTQQNVKAVFDAAIKVVLQP
PKQKKKKKNKNRCVFL

Other information
Ka divergence:-0.288188KaKs divergence:-0.569492
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):588Length 2 (bp):591Length divergence:0.003
MFE 1 (kcal):-171.11MFE 2 (kcal):-175.1MFE divergence0.012