Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20100-AT1G75860
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-2.29723462727
Log2 mRNA fold difference:-1.3225840801084
Log2 TE fold difference:-1.0288395320994
Sequences
Protein sequence

MSRYFTSPPPVYARNWANGQNLVEWTKIERPIVDSKKLHRKEKKEKKKEKKLKKEKKSLE
QKYSTTKTVSYESEQLEKSCLTEEFEQPQVGYLSDGSQNSKKRRRETSPAVVESQIKATP
VAGKPLRIRIVFKKPKEAEAVPQEDPVCSTSGTQRPSELPSSVSLPSICDHDVAVPSTSL
ESGKVAIISESKKRKKHKPSKESRYNSLFDELVPPCISLEEDDSSSDDWLFGTSRKENVS
SAKSSYKTDEDTIMSLQTSRDCSSLPRAMLLSEVGIFSLPYTVPF

MSRVLTCPPLVFARNHVGVQNLVESTKLKRITLDSKKAHRIEKKEKKEKRKEKKETKREK
SHKHSIKATDNHHKLIFLPSKKVSDESDSLEKSGLTDELEEPQKHLGYLSDGSQNSKKRI
RDDSPPAVESLIKAAPVAGKPLRIRMVFKKPKEEVPTLPREAVVCSTTVAKSLSHQDVIT
SSISSSKTSELEKNLPSTSIAAIDETKKRKKHRSSKEDQYNALFDGWTPPSMCIADASSN
DNGDYWLFGNKTQEVLKPKAAVKVDDDTMMRPGDSSWPRAQFLSEVGIYSLPYTVPF

www.000webhost.com

Other information
Ka divergence:0.197083KaKs divergence:0.217943
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):858Length 2 (bp):894Length divergence:0.021
MFE 1 (kcal):-226.06MFE 2 (kcal):-256.3MFE divergence0.063