Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20200-AT1G75990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):PAM domain (PCI/PINT associated module) protein
Function (paralog2):PAM domain (PCI/PINT associated module) protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.43414816882365
Log2 mRNA fold difference:-0.66412822510136
Log2 TE fold difference:0.26422239912508
Sequences
Protein sequence

MTQDVEMKDNNTPSQSIISSSTSTMQNLKEIAALIDTGSYTKEVRRIARAVRLTIGLRQK
LTGSVLSSFLDFALVPGSEAHSRLSSFVPKGDEHDMEVDTASSATQAAPSKHLPAELEIY
CYFIVLLFLIDQKKYNEAKACSSASIARLKNVNRRTIDVIASRLYFYYSLSYEQTGDLAE
IRGTLLALHHSATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFC
RYLFYLGKIRTIQLEYTDAKESLLQAARKAPIAALGFRIQCNKWAILVRLLLGEIPERSI
FTQKGMEKALRPYFELTNAVRIGDLELFRTVQEKFLDTFAQDRTHNLIVRLRHNVIRTGL
RNISISYSRISLPDVAKKLRLNSENPVADAESIVAKAIRDGAIDATIDHKNGCMVSKETG
DIYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHKEKESDEKRRERKQQEEELAKHM
AEEDDDDF

MTQDVEMKDNQTPTQSVVSAPTSTLQNLKEIAALIDTGSYTKEVRRIARAVRLTVGLRRK
LTGSVISSFLDFALVPGSEAHTRLSSFVPKSDEHDMEVDTASSNSQAPPKHLPAELEIYC
YFIVLLFLIDQKKYNEAKVCSTASIARLKSVNRRTVDVIASKLYFYYSLSYELTNDLAEI
RSTLLALHHSATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFCR
YLFYLGKIRTIQLEYTDAKESLLQAARKAPVASLGFRIQCNKWAIIVRLLLGEIPERSIF
TQKGMEKTLRPYFELTNAVRIGDLELFGKIQEKFAKTFAEDRTHNLIVRLRHNVIRTGLR
NISISYSRISLQDVAQKLRLNSANPVADAESIVAKAIRDGAIDATIDHKNGCMVSKETGD
IYSTNEPQTAFNSRIAFCLNMHNEAVRALRFPPNTHREKESEEKRREMKQQEEELAKYMA
EEDDDDF

Other information
Ka divergence:0.42526KaKs divergence:0.530988
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1467Length 2 (bp):1464Length divergence:-0.001
MFE 1 (kcal):-468.43MFE 2 (kcal):-433.59MFE divergence-0.039