Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20220-AT1G76010
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Alba DNA/RNA-binding protein
Function (paralog2):Alba DNA/RNA-binding protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:1.2770587977172
Log2 mRNA fold difference:1.6311727132775
Log2 TE fold difference:-0.33333236268511
Sequences
Protein sequence

MDKYQRVEKPKADTPIAENEIRITSMGRARNYITYAMALLQENKSNEVIFKAMGRAINKS
VTIVELIKRRIPGLHQITSIGSTDITDTWEPTEEGLQTIETTRHVSMITITLSKEQLNTS
SVGYQCPIPIEMVKPLAEIDYEGQDGSPRGRGGRRGRGGRGRGRGRGGRGNGPANVEYDD
GGRGRGGRGNGYVNNEYDDGGRGRGGRGSGYVNNEYNDGGMEQDRSYGRGRGRGRGGGRG
GRGRGGYNGPPPPYYEAQQDGGDYGYNNVAPPADHGYDGPPPQGRGRGRGRGGRGRGGGR
GGFNRSNGAPIQAAA

MDKYQRVVKPKADTPIDANEIRITSQGRARNYITYAMTLLQDKGSTEVVFKAMGRAINKT
VTIVELIKRRIPDLHQNTSIGSTDITDTWEPTEEGLLPLETTRHVSMITITLSKIELNTS
SVGYQCPIPIELVKPMGDIDYEGREGSPGGRGRGRGRGRGRGRGRGGRGNAYVNVEHEDG
GWEREQSYGRGRGRGRGRSSRGRGRGGYNGPPNEYDAPQDGGYGYDAPHEHRGYDDRGGY
DAPPQGRGGYDGPQGRGGYDGPQGRRGYDGPPQGRGGYDGPSQGRGGYDGPSQGRGGYDG
PSQGRGGYDGPQGRGRGRGRGRGGRGRGGGRGGDGGFNNRSDGPPVQAAA

Other information
Ka divergence:-0.22442KaKs divergence:-0.218072
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):948Length 2 (bp):1053Length divergence:0.052
MFE 1 (kcal):-266.14MFE 2 (kcal):-400.89MFE divergence0.202