Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20260-AT1G76030
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ATPase, V1 complex, subunit B protein
Function (paralog2):ATPase, V1 complex, subunit B protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.34156341665334
Log2 mRNA fold difference:0.0080913186383187
Log2 TE fold difference:0.33569523401387
Sequences
Protein sequence

MVETSIDMEEGTLEIGMEYRTVSGVAGPLVILDKVKGPKYQEIVNIRLGDGSTRRGQVLE
VDGEKAVVQVFEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPE
AYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQICR
QAGLVKRLEKTENLIQEDHGEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNL
ANDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGY
PGYMYTDLATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQL
HNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHSDVSNQLYANYAIGKDVQAMKAVVGEEA
LSSEDLLYLEFLDKFERKFVMQGAYDTRNIFQSLDLAWTLLRIFPRELLHRIPAKTLDQF
YSRDSTS

MGTNDLDIEEGTLEIGMEYRTVSGVAGPLVILDKVKGPKYQEIVNIRLGDGSTRRGQVLE
VDGEKAVVQVFEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPE
AYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQICR
QAGLVKRLEKTVDLLEDHGEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNLA
NDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGYP
GYMYTDLATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLH
NRQIYPPINVLPSLSRLMKSAIGEGMTRKDHSDVSNQLYANYAIGKDVQAMKAVVGEEAL
SSEDLLYLEFLDKFERKFVMQGAYDTRNIFQSLDLAWTLLRIFPRELLHRIPAKTLDQFY
SRDSTS

www.000webhost.com

Other information
Ka divergence:-0.0441511KaKs divergence:0.0582011
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1464Length 2 (bp):1461Length divergence:-0.001
MFE 1 (kcal):-434.99MFE 2 (kcal):-431.55MFE divergence-0.004