Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20310-AT1G76070
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-0.056926320832669
Log2 mRNA fold difference:-0.52247028831212
Log2 TE fold difference:0.54193339711051
Sequences
Protein sequence

MEKASNSNKSTKFSKMLQRAMSIGHSAAPFSPRRDFHQHRTTSTANRGIFFSSPLVPTAA
RVRRNTKYEAVFAEPTSPKVSCIGQVKLARPKCPEKKNKAPKNLKTASSLSSCVIKEEDN
GSFSKLKRIFSMRSYPSRKSNSTAFAAAAAREHPIAEVDAVTAAPSLGAMKKFASSREAL
GGFDWTVQMKREKEDVMIPCSVGIPLTQLEDLSLCPKPKSEVNLWKRRTMDRPKPLQVIK

MDIKHHTSTSKPKNKNKLLKMLPKAMSFGHRVPPFSPGRDLHHNNHHNYTAANKMFFSGP
MVPLVPNAARVRRNKSDAVWDEPTSPKVSCIGQIKLGKSKCPTGKKNKAPSSLIPKISKT
STSSLTKEDEKGRLSKIKSIFSFSPASGRNTSRKSHPTAVSAADEHPVTVVSTAAVPSLG
QMKKFASSRDALGDFDWAVEMKHEEESPADHHRGYYSDDDTRGAYLRYDDDEDEDDIIIP
FSAPLGLKPKKEVNLWKRRTMDPPKPLHLQTI

Other information
Ka divergence:-0.20738KaKs divergence:0.0619843
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):723Length 2 (bp):819Length divergence:0.062
MFE 1 (kcal):-211.9MFE 2 (kcal):-217.11MFE divergence0.012