Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20330-AT1G76090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):sterol methyltransferase 2
Function (paralog2):sterol methyltransferase 3

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-1.5758475160398
Log2 mRNA fold difference:-2.0022913701239
Log2 TE fold difference:0.464428837788
Sequences
Protein sequence

MDSLTLFFTGALVAVGIYWFLCVLGPAERKGKRAVDLSGGSISAEKVQDNYKQYWSFFRR
PKEIETAEKVPDFVDTFYNLVTDIYEWGWGQSFHFSPSIPGKSHKDATRLHEEMAVDLIQ
VKPGQKILDVGCGVGGPMRAIASHSRANVVGITINEYQVNRARLHNKKAGLDALCEVVCG
NFLQMPFDDNSFDGAYSIEATCHAPKLEEVYAEIYRVLKPGSMYVSYEWVTTEKFKAEDD
EHVEVIQGIERGDALPGLRAYVDIAETAKKVGFEIVKEKDLASPPAEPWWTRLKMGRLAY
WRNHIVVQILSAVGVAPKGTVDVHEMLFKTADYLTRGGETGIFSPMHMILCRKPESPEES
S

MDSVALYCTAGLIAGAVYWFICVLGPAERKGKRASDLSGGSISAEKVKDNYNQYWSFFRK
PKEIESAEKVPDFVDTFYNLVTDIYEWGWGQSFHFSPHVPGKSDKDATRIHEEMAVDLIK
VKPGQKILDAGCGVGGPMRAIAAHSKAQVTGITINEYQVQRAKLHNKKAGLDSLCNVVCG
NFLKMPFDENTFDGAYSIEATCHAPKLEEVYSEIFRVMKPGSLFVSYEWVTTEKYRDDDE
EHKDVIQGIERGDALPGLRSYADIAVTAKKVGFEVVKEKDLAKPPSKPWWNRLKMGRIAY
WRNHVVVVILSAIGVAPKGTVDVHKMLFKTADYLTRGGETGIFSPMHMILCRKPEKASE

Other information
Ka divergence:0.389223KaKs divergence:0.207026
GC content 1 (%):50GC content 2 (%):47GC content divergence:-0.031
Length 1 (bp):1086Length 2 (bp):1080Length divergence:-0.003
MFE 1 (kcal):-381.2MFE 2 (kcal):-335.82MFE divergence-0.063