Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20340-AT1G76100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cupredoxin superfamily protein
Function (paralog2):plastocyanin 1

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-4.7456063646824
Log2 mRNA fold difference:-5.0009346097051
Log2 TE fold difference:0.18208350642411
Sequences
Protein sequence

MASVTSATVAIPSFTGLKASTIKSSATVRIQTAAVASPKLTVKSSLKNFGVAAVAAAASI
ALAGNAMAIEVLLGGGDGSLAFIPNDFSIAKGEKIVFKNNAGYPHNVVFDEDEIPSGVDV
AKISMDEQDLLNGAGETYEVALTEPGTYSFYCAPHQGAGMVGKVTVN

MAAITSATVTIPSFTGLKLAVSSKPKTLSTISRSTSATRAPPKLALKSSLKDFGVIAVAT
AASIVLAGNAMAMEVLLGSDDGSLAFVPSEFTVAKGEKIVFKNNAGFPHNVVFDEDEIPS
GVDASKISMDETALLNGAGETYEVTLTEPGSYGFYCAPHQGAGMVGKLTVK

Other information
Ka divergence:0.182054KaKs divergence:0.195164
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):504Length 2 (bp):516Length divergence:0.012
MFE 1 (kcal):-174.8MFE 2 (kcal):-159.88MFE divergence-0.045