Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20370-AT1G76120
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Pseudouridine synthase family protein
Function (paralog2):Pseudouridine synthase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:-2.133922667658
Log2 mRNA fold difference:-2.0168075145967
Log2 TE fold difference:-0.20413906310713
Sequences
Protein sequence

MENQEPDIEKLPRDDVPDREPDHKKLKISTTGQETDSSAVTTGGSNVAERRAPKYRRRKV
AIVFAFCGVGYQGMQKNPGAKTIEGELEEALFHAGAVPDADRNKPRNYEWARSARTDKGV
SAVGQVVSGRFYVDPPGFVERLNSKLPDQIRVFGYKRVAPSFSSKKFCDRRRYVYLIPVF
ALDPCVHGEAEMVRTDLGYEYVKCVECSEKGYKIPLGVMGKDTDCCDTKSLEIQSDISSS
TCDAIGADVKCETLSSSVPSAENNLNSEVLDGADVSALSSKAEGMEESNTLAKVEMNNGE
GEDMTKSESKFCYGEKEKERFNRILSYYVGSHNFHNFTTRTKAADPAANRYILSFNANTV
INLDGKDFVKCEVVGQSFMLHQIRKMIGLAVAIMRNYAPESLIEASFKKDVRINVPMAPE
VGLYLDECFFTSYNKRFKGSHEEVSMEEYKEVAEEFKWKYVYSHIGSAEEKDGAVAIWLH
SLNQRNYPDLRSNEYQPDEVIVYKKIGEASEENIHEGNAELFVVDKVNDETSEGTTMEER
TTLEEKATG

MLTTTTDEEIDLSCDGGVTEPQKVAIIFAFCGVGYQGMQKNPGAKTIEGELEEALFHAGA
VPESIRGKPKLYDFARSARTDKGVSAVGQVVSGRFIVDPLGFVNRLNSNLPNQIRIFGYK
HVTPSFSSKKFCDRRRYVYLLPVFALDPISHRDRETVMASLGPGEEYVKCFECSERGRKI
PPGLVGKWKGTNFGTKSLDFQSDISSNNSSALRSDIKIEALSSNLAGLCSVDVEVGRIQE
DSCKLNTNSSETKVKSKFCYGEKEKERFSRILSCYVGSYNFHNFTTRTKADDPTANRQII
SFTANTVINLDGIDFIKCEVLGKSFMLHQIRKMMGLAVAIMRNCASESLIQSAFSKDVNI
TVPMAPEVGLYLDECFFTSYNRNFEDSHEEVSMEAYKEEAEAFKLKHIYSHIGATERKYG
NMALWLHSLNYRNYPDLNFGSCGQNTDQVLVHKKIDERASHSL

Other information
Ka divergence:0.0114602KaKs divergence:0.0252101
GC content 1 (%):44GC content 2 (%):40GC content divergence:-0.048
Length 1 (bp):1650Length 2 (bp):1392Length divergence:-0.085
MFE 1 (kcal):-484.2MFE 2 (kcal):-388.4MFE divergence-0.11