Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20380-AT1G76140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Prolyl oligopeptidase family protein
Function (paralog2):Prolyl oligopeptidase family protein

Regulation information
Data set:seedling-stress_Juntawong_2013
Log2 RF fold difference:3.3524271507746
Log2 mRNA fold difference:3.8987117849876
Log2 TE fold difference:-0.61561980421971
Sequences
Protein sequence

MGSLPAFEERLQYPTARRDESVVEDYHGVKVSDPYRWLEDPDAEEVKEFVEKQVQLSDSV
LKSCETKEKLHDKFTKFIDYPRFDTPFKRGNSYFYFHNSGLQAQSVLHVQDDLESEAEIL
LDPNTLSDDGTVSLNTLSISEDAKYLAYGLSSSGSDWVTIKVMKIEDKKVEPDSLSWVKF
SGITWTHDGKGFFYSRYPAPREGEKIDAGTETNSNLYHELYYHFLGTDQSEDVLCWRDQD
NPKHMFGSKVTDDGKYLIMSIEEGCDPVNKVYHCDLSLLPKGLEGFRGSNTLLPFVKLID
TFDAQYIAIANDETLFTFLTNKDAPKYKVVRVDLKEPSSWTDVIAEHEKDVLSTASAVNG
DQLVVSYMSDVKHILQIRDLKSGSLLHGLPVDIGSVCGVFARRKDTTFFFRFTSFLTPGV
IYICDLSHEAPEVTVFREIGVPGFDRTAFQVTQVFYPSKDGTDIPMFIVARKDIKLDGSH
PCLLYAYGGFSISMTPFFSATRIVLGRHLGTVFCFANIRGGGEYGEEWHKSGALANKQNC
FDDFISGAEYLVSAGYTQPRKLCIEGGSNGGILVGACINQRPDLFGCALAHVGVMDMLRF
HKFTIGHAWTSEFGCSDKEEEFHWLIKYSPLHNVKRPWEQKTDLFFQYPSTMLLTADHDD
RVVPLHSYKLLATMQYELGLSLENSPQTNPIIARIEVKAGHGAGRPTQKMIDEAADRYSF
MAKMVDASWID

MLTAFASHARSHVFAFVTVPTITRRLRINILRQSPLSSSLLLNETFSNRPNSVSRRCYCS
SSAIMGSSSVFGEQLQYPATRRDDSVVDDYHGVKIGDPYRWLEDPDAEEVKEFVQSQVKL
TDSVLEKCETKEKLRQNITKLIDHPRYDSPFRQGDKYFYFHNTGLQAQSVLYMQDNLDAE
PEVLLDPNTLSDDGTVALNTFSVSEDAKYLAYGLSSSGSDWVTIKLMKIEDKKVEPDTLS
WVKFTGITWTHDSKGFFYGRYPAPKEGEDIDAGTETNSNLYHELYYHFIGTDQSQDILCW
RDNENPKYMFGAEVTDDGKYLIMSIGESCDPVNKLYYCDMTSLSGGLESFRGSSSFLPFI
KLVDTFDAQYSVISNDETLFTFLTNKDAPKYKLVRVDLKEPNSWTDVVEEHEKDVLASAC
AVNGNHLVACYMSDVKHILQIRDLKSGSLLHQLPLDIGSVSDVSARRKDNTFFFSFTSFL
TPGVIYKCDLANESPEVKVFREVTVPGFDREAFQAIQVFYPSKDGTKIPMFIVAKKDIKL
DGSHPCLLYAYGGFNISITPSFSASRIVLSKHLGVVFCFANIRGGGEYGEEWHKAGSLAK
KQNCFDDFISGAEYLVSAGYTQPSKLCIEGGSNGGLLVGACINQRPDLYGCALAHVGVMD
MLRFHKFTIGHAWTSDYGCSENEEEFHWLIKYSPLHNVKRPWEQQTDHLVQYPSTMLLTA
DHDDRVVPLHSLKLLATLQHVLCTSLDNSPQMNPIIGRIEVKAGHGAGRPTQKMIDEAAD
RYSFMAKMVNASWTE

Other information
Ka divergence:-0.121619KaKs divergence:-0.0803525
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):2196Length 2 (bp):2388Length divergence:0.042
MFE 1 (kcal):-661.7MFE 2 (kcal):-728.32MFE divergence0.048