Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20440-AT1G20450
Species:Arabidopsis
Duplication type:TD
Function (paralog1):cold-regulated 47
Function (paralog2):Dehydrin family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-1.9006081002993
Log2 mRNA fold difference:-2.2600061855828
Log2 TE fold difference:0.49204565019752
Sequences
Protein sequence

MAEEYKNNVPEHETPTVATEESPATTTEVTDRGLFDFLGKKEEEVKPQETTTLESEFDHK
AQISEPELAAEHEEVKENKITLLEELQEKTEEDEENKPSVIEKLHRSNSSSSSSSDEEGE
EKKEKKKKIVEGEEDKKGLVEKIKEKLPGHHDKTAEDDVPVSTTIPVPVSESVVEHDHPE
EEKKGLVEKIKEKLPGHHDEKAEDSPAVTSTPLVVTEHPVEPTTELPVEHPEEKKGILEK
IKEKLPGYHAKTTEEEVKKEKESDD

MAEEYKNTVPEQETPKVATEESSAPEIKERGMFDFLKKKEEVKPQETTTLASEFEHKTQI
SEPESFVAKHEEEEHKPTLLEQLHQKHEEEEENKPSLLDKLHRSNSSSSSSSDEEGEDGE
KKKKEKKKKIVEGDHVKTVEEENQGVMDRIKEKFPLGEKPGGDDVPVVTTMPAPHSVEDH
KPEEEEKKGFMDKIKEKLPGHSKKPEDSQVVNTTPLVETATPIADIPEEKKGFMDKIKEK
LPGYHAKTTGEEEKKEKVSD

www.000webhost.com

Other information
Ka divergence:-0.283417KaKs divergence:-0.355392
GC content 1 (%):49GC content 2 (%):47GC content divergence:-0.021
Length 1 (bp):798Length 2 (bp):783Length divergence:-0.009
MFE 1 (kcal):-232.96MFE 2 (kcal):-220.51MFE divergence-0.027