Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20460-AT1G76185
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.8318254404335
Log2 mRNA fold difference:0.30767584672301
Log2 TE fold difference:0.85112628123874
Sequences
Protein sequence

MITRSNLAEQLREYQIRSKHDWASVSFFSSTSNFSSSRVDVVVFVIWELVILAFFVFSAV
SLYFKRLQLAFILVCVTLLLLICMKVTKQVRLARKKKRRMLLPLSM

MITRSNLAEQLREYQIRSKHDWASVSFFSSTSNFSSSRVDVVVFVIWELVMLALVVFSAV
SLYFRRLQLAFILLCVTLLLLLCMKITKQVRHARKKKRRMLLPLSM

www.000webhost.com

Other information
Ka divergence:0.144917KaKs divergence:0.0532446
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):321Length 2 (bp):321Length divergence:0
MFE 1 (kcal):-90.49MFE 2 (kcal):-74.73MFE divergence-0.095