Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20470-AT1G76190
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SAUR-like auxin-responsive protein family
Function (paralog2):SAUR-like auxin-responsive protein family

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.4851992965423
Log2 mRNA fold difference:-0.11843642529039
Log2 TE fold difference:0.17691862874846
Sequences
Protein sequence

MSLKKRSCSRLRLTDLMEKWRKCKKGHFAVYTREGRRFVLPLDYLKHPIFQVLLEMAEEE
FGSTICGPLQVPCDGGLMDHILMLLRNKSLSDHDDDGGDDGVKKTMNQDVSPMSTSCKGA
SSVSYFFPLFRCNAAHDQSKLQSLVF

MKKLNSKGIRLSELMEKWRRRKKGHFAVYTNEGKRFVLPLDYLNHPMLQVLLQMAEDEFG
TTIDGPLKVPCDGSLMDHIIMLVRRSMSHDYDDVEKSSTSSTCKGASISSLFRGQSQLQS
LVS

www.000webhost.com

Other information
Ka divergence:0.272146KaKs divergence:-0.999714
GC content 1 (%):46GC content 2 (%):43GC content divergence:-0.034
Length 1 (bp):441Length 2 (bp):372Length divergence:-0.085
MFE 1 (kcal):-133.1MFE 2 (kcal):-125.3MFE divergence-0.03