Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20480-AT1G20490
Species:Arabidopsis
Duplication type:TD
Function (paralog1):AMP-dependent synthetase and ligase family protein
Function (paralog2):AMP-dependent synthetase and ligase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.68120196739491
Log2 mRNA fold difference:0.09448209368694
Log2 TE fold difference:-0.79876053602268
Sequences
Protein sequence

MAVKHGVDGDGSEIESRTLAVDRKSGFCESTSIFYSKREPMALPPNQFLDVTSFIASQPH
RGKTVFVDAVTGRRLSFPELWLGVERVAGCLYALGVRKGNVVIILSPNSILFPIVSLSVM
SLGAIITTANPINTSDEISKQIGDSRPVLAFTTCKLVSKLAAASNFNLPVVLMDDYHVPS
QSYGDRVKLVGRLETMIETEPSESRVKQRVNQDDTAALLYSSGTTGTSKGVMLSHRNLIA
LVQAYRARFGLEQRTICTIPMCHIFGFGGFATGLIALGWTIVVLPKFDMAKLLSAVETHR
SSYLSLVPPIVVAMVNGANEINSKYDLSSLHTVVAGGAPLSREVTEKFVENYPKVKILQG
YGLTESTAIAASMFNKEETKRYGASGLLAPNVEGKIVDPDTGRVLGVNQTGELWIRSPTV
MKGYFKNKEATASTIDSEGWLKTGDLCYIDGDGFVFVVDRLKELIKCNGYQVAPAELEAL
LLAHPEIADAAVIPIPDMKAGQYPMAYIVRKVGSNLSESEIMGFVAKQVSPYKKIRKVTF
LASIPKNPSGKILRRELTKLTTSKL

MAYPERDLIVDPRSGFCKSNSTFYSKRNPLCLPPNPSLDVTTFISSQPQRGTTAFIDAST
GHRLTFSDLWRVVDRVADCLYHEVGIRRGDVVLILSPNSIYIPVVCLSVMSLGAVVTTAN
TLNTSGEISKQIAQSNPTLVFTTSQLAPKLAAAISVVLTDEEDEKRVELTSGVRVVGILS
EMMKKETSGQRVRDRVNQDDTAMMLYSSGTTGTSKGVISSHRNLTAYVAKYIDDKWKRDE
IFVCTVPMFHSFGLLAFAMGSVASGSTVVILRRFGLDDMMQAVEKYKATILSLAPPVLVA
MINGADQLKAKYDLTSLRKVRCGGAPLSKEVMDSFLEKYPTVNIFQGYALTESHGSGAST
ESVEESLKYGAVGLLSSGIEARIVDPDTGRVMGVNQPGELWLKGPSISKGYFGNEEATNE
TINLEGWLKLEISAISMKMGFYLLWID

www.000webhost.com

Other information
Ka divergence:0.074352KaKs divergence:0.32014
GC content 1 (%):47GC content 2 (%):50GC content divergence:0.031
Length 1 (bp):1698Length 2 (bp):1344Length divergence:-0.116
MFE 1 (kcal):-549.32MFE 2 (kcal):-455.34MFE divergence-0.094