Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20540-AT1G76260
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transducin/WD40 repeat-like superfamily protein
Function (paralog2):DWD (DDB1-binding WD40 protein) hypersensitive to ABA 2

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:-0.071916500904923
Log2 mRNA fold difference:-0.82798088610707
Log2 TE fold difference:0.74441241049573
Sequences
Protein sequence

MQGGSSGIGYGLKYQSRCISDVKADTDYTSFLTGTLSLKEENEVHLLRLSSGGSELICEG
LFSHPNEIWDLASCPFDQRIFSTVFSTGESFGAAIWQIPELYGQLNSPQLERVASLDAHV
GKINCVLWWPSGRCDKLISIDEQNIFLWSLDCSKKSAEVLSKDSAGMLHSLSGGAWDPHD
VNAVAATGESSVQFWDLRTMKKVNSIEHAHVRGVDYNPKREHILVTAEDESGIHVWDLRK
AKVPVQELPGHTHWTWAVRCNPEYDGLILSAGTDSVVNLWYASATSSDDKTSESPVESTR
QRVNPLLNSYTDYEDSVYGLAWSSREPWVFASLSYDGRVIIESVKPFLPRI

MQGGSSGIGYGLKYQARCISDVKADRDHTSFLTGTLSLKEENEVHLLRLSSGGSELLCEG
LFSHPNEIWDLASSPFDQRIFSTVFSTGDSYGAAIWQIPEPYGQSNSSTLECVASLDAHV
GKINCVLWCPSGNSDKLISMDEQNLVFWSLDSSKKSAEVLSKESAGMRHSLSGGAWNPHD
VNSVAATSESSIQFWDLRTMKKNNSIERAHVRNVDYNLKREHILVSADDESGIHLWDLRK
TKFPVQELPGHTHWTWAVRCNPEYEELILSVGTDSAVNLWFASASSEHKTSESPVEASRQ
RVNPLLNSYTDYEDSVYGLAWSSREPWIFASLSYDGRVVIESVKPFLPRR

www.000webhost.com

Other information
Ka divergence:0.243737KaKs divergence:0.640123
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1056Length 2 (bp):1053Length divergence:-0.001
MFE 1 (kcal):-326.73MFE 2 (kcal):-314.8MFE divergence-0.019