Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT1G20550-AT1G76270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):O-fucosyltransferase family protein
Function (paralog2):O-fucosyltransferase family protein

Regulation information
Data set:seedling_Juntawong_2013
Log2 RF fold difference:0.21165022019778
Log2 mRNA fold difference:0.88239533125484
Log2 TE fold difference:-0.7485989529666
Sequences
Protein sequence

MAFQRRRNNYYNRLRRLLPFICAVSGALLILFALLSILSPPPDDSDRRISKHINYGANDE
KKNTPVVFTVPRGGGRSDRDIWRSWNAEFFYGCCNASSKFPNAKAITRNDRYLAIATSGG
LNQQRTGIVDAVVAARILNATLVIPKLDQKSYWKDASDFSNIFDVDWFMSFLSKDVKIIE
KLPQKGGQTWSPRRMRVPRKCNEKCYINRVLPVLQKRHAVQLNKFDYRLSNKLRDDLQKL
RCRVNYHALKFTDPILEMGNELVRRMRKRSKHFIALHLRFEPDMLAFSGCYYGGGEKEKK
ELGTIRRRWKTLHVNNPEKQRRQGRCPLTPEEVGLMLRALGYGSDVHIYVASGEVYGGEK
SLAPLKALFPHFYSKDTIATKMELKPFSSYSSRMAALDFLVCDESDVFVTNNNGNMARIL
AGRRRYFGHKPTIRPNAKKLYKLFMSKENTTWEEFASRVRTFQKGFMGEPKEVRAGKGEF
HENPAACICEDTDAKVKAGKMDSRKFGKKEQKEDEDAELSSSETDYEEDQTDLQDRGLYN
GTRLDYDDALSVSEEPELEEMLSD

MNFHRRRYPYYNRLRRLLPLVIAVSLSLLILFAFLSFLAPPPGDSDRLPPRVRYSSNDAI
KATGFHIPRAGGRSDRDIWRSRNAEFFFGCSNASSKFANSKAVTRNDRYLVIATSGGLNQ
QRTGIVDAVVAARILNATLVVPKLDQKSYWKDASDFSHIFDVDWFISFLSGDVRIIKQLP
LKGGRTWSTSRMRVPRKCNERCYINRVLPVLLKRHAVQLNKFDYRLSNKLSDDLQKLRCR
VNYHALKFTDPILTMGNELVRRMRLRSKHFIALHLRYEPDMLAFSGCYYGGGDKERRELA
AIRRRWKTLHINNPEKQRRQGRCPLTPEEVGLMLRALGYGSDVHIYVASGEVYGGEESLA
PLKALFPHFYSKDTIATKEELEPFSSYSSRMAALDFLVCDESDVFVTNNNGNMAKILAGR
RRYLGHKPTVRPNAKKLYRLFMNKENTTWEEFSSKVRSFQRGFMGEPKEVRAGRGEFHEN
PSTCICEDTEAKAKAQLESRKLGKKNKSTNKDAAVTVTNDDQTEEDDPDWSEPDYEEEQS
DLQDRGLYNGTSLDYDDPSTSDEPELEAMLSD

Other information
Ka divergence:-0.203869KaKs divergence:0.0842912
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1695Length 2 (bp):1719Length divergence:0.007
MFE 1 (kcal):-490.89MFE 2 (kcal):-476.2MFE divergence-0.015